PRGDB00194125 (Mes.15046)

From PRG Wiki
Jump to: navigation, search
Mes.15046
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 164399948 (DB946951)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Manihot esculenta

Comment?

DB946951 full-length enriched cassava cDNA library Manihot esculenta cDNA clone CAS01_026_H11 3', mRNA sequence

DNA Sequence

GCAAAGAATACATTATATAACTAATTAAGAACAATTCACAAGATGATTACCTTTGAAGCAGTCGAGCTTGAAGAAGCCTATTTTTTATACGACCAAGTTGAGAAAAAGCATCACTAATACTCATTCGTTCTCTTGGTAACTCAGCAGAACAAGATATTCCGATTTCAAATATTGAAATTGAACACTCAAACAATATGTCATTATTCTGCATGTGAGTGTGATTTGGAAATGAATTGCCCATATTCGTGGATCTTCCTTCAATGAGAATTGGATCTATAATATTTGATACTCTTTCGGGTAAAGCTACTTTGACGAAATTATGAAGATTCAGACCTTCCATAAATGTGCTATCAGTAGGTCTTTTCCCTGTGAACATCTCCAATAAAAGTATGCCATAGCTATATATGTCACCATAAGTTGACACTTCTCTTCCCGTTCCGTACTCTGGAGGAGCATAACCGATTGTTCCTCTTACGCCGAAAGAACTTGACTCATTTGTTGAATTATGAAGTGTTTCTTCAGAAAAGAACTTTGCTAACCCAAAATCACTTACATGCCCAGTCATTTCATTGTCG


Protein sequences

Name Description Sequence
Mes.15046 translated coding region predicted by ESTScan from UniGene Mes.15046

XDNEMTGHVSDFGLAKFFSEETLHNSTNESSSFGVRGTIGYAPPEYGTGREVSTYGDIYSYGILLLEMFTGKRPTDSTFMEGLNLHNFVKVALPERVSNIIDPILIEGRSTNMGNSFPNHTHMQNNDILFECSISIFEIGISCSAELPRERMSISDAFSQLGRIKNRLLQARLLQR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-169 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XDNEMTGHVSDFGLAKFFSEETLHNSTNESSSFGVRGTIGYAPPEYGTGREVSTYGDIYSYGILLLEMFTGKRPTDSTFMEGLNLHNFVKVALPERVSNIIDPILIEGRSTNMGNSFPNHTHMQNNDILFECSISIFEIGISCSAELPRERMSISDAFSQLGRIKNRLL

superfamily: SSF56112
IPR011009
2-159 Protein kinase-like (PK-like)
Protein kinase-like domain

DNEMTGHVSDFGLAKFFSEETLHNSTNESSSFGVRGTIGYAPPEYGTGREVSTYGDIYSYGILLLEMFTGKRPTDSTFMEGLNLHNFVKVALPERVSNIIDPILIEGRSTNMGNSFPNHTHMQNNDILFECSISIFEIGISCSAELPRERMSISDAFS

HMMPanther: PTHR24420
2-165 FAMILY NOT NAMED,FAMILY NOT NAMED

DNEMTGHVSDFGLAKFFSEETLHNSTNESSSFGVRGTIGYAPPEYGTGREVSTYGDIYSYGILLLEMFTGKRPTDSTFMEGLNLHNFVKVALPERVSNIIDPILIEGRSTNMGNSFPNHTHMQNNDILFECSISIFEIGISCSAELPRERMSISDAFSQLGRIK

HMMPanther: PTHR24420:SF474
2-165 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DNEMTGHVSDFGLAKFFSEETLHNSTNESSSFGVRGTIGYAPPEYGTGREVSTYGDIYSYGILLLEMFTGKRPTDSTFMEGLNLHNFVKVALPERVSNIIDPILIEGRSTNMGNSFPNHTHMQNNDILFECSISIFEIGISCSAELPRERMSISDAFSQLGRIK

Gene3D: G3DSA:1.10.510.10
3-159 no description

NEMTGHVSDFGLAKFFSEETLHNSTNESSSFGVRGTIGYAPPEYGTGREVSTYGDIYSYGILLLEMFTGKRPTDSTFMEGLNLHNFVKVALPERVSNIIDPILIEGRSTNMGNSFPNHTHMQNNDILFECSISIFEIGISCSAELPRERMSISDAFS

HMMPfam: PF00069
IPR000719
4-78 Pkinase,Ser-thr
Protein kinase, catalytic domain

EMTGHVSDFGLAKFFSEETLHNSTNESSSFGVRGTIGYAPPEYGTGREVSTYGDIYSYGILLLEMFTGKRPTDST






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox