PRGDB00194127 (Mes.19369)

From PRG Wiki
Jump to: navigation, search
Mes.19369
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 164381385 (DB939698)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Manihot esculenta

Comment?

DB939698 full-length enriched cassava cDNA library Manihot esculenta cDNA clone CAS01_003_L10 3', mRNA sequence

DNA Sequence

CTCAACTTGGCTAACCCGAAATCTGAAATTTTTGGACAAAAATCATCACCCAGGAGTATATTTTCAGGCTTGATATCACAGTGCAAAACCCATTCCAGACACTCTTCATGTAAGTATGCAATTGCTCTTGCCACACCAAGTGCGATCCTGTATCTGATCCCCCAATCGAGTATGGGTTTCCGGCCGTCAATAGCCACAGGACCCATCTCCATCTCCGATCCTGAAGATGCAACCTGACCCGCAGGAAACAGGTACTTATCAAGGGATCCATTAGGCACATACTCGTAAACTAAAATCCTCTGCCCTTTCTCAGCACAAAAAGCCCCATAACCTGACTAAATTGAGATGGTGCATCCTGGCAATAATAGTAACCTCTGCCCAGAACTCAGCATCGCCTCCGGTGACATGTTTCAAGCACTTAATGGCAACAATTCGCTTATCAGGTAGATATCCTCTGTAAACATCACCGAATCCACCTCTCCCAATAGCAAAAAATTTCGGATTTCCATCAGTTGCTGCTTTGAGCTCTGCATATGTGAACCGT


Protein sequences

Name Description Sequence
Mes.19369 translated coding region predicted by ESTScan from UniGene Mes.19369

XRFTYAELKAATDGNPKFFAIGRGGFGDVYRGYLPDKRIVAIKCLKHVTGGDAEFWAEVTIIARMHHLNLSGYGAFCAEKGQRILVYEYVPNGSLDKYLFPAGQVASSGSEMEMGPVAIDGRKPILDWGIRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLGDDFCPKISDFGLAKLX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-181 Protein kinase-like (PK-like)
Protein kinase-like domain

XRFTYAELKAATDGNPKFFAIGRGGFGDVYRGYLPDKRIVAIKCLKHVTGGDAEFWAEVTIIARMHHLNLSGYGAFCAEKGQRILVYEYVPNGSLDKYLFPAGQVASSGSEMEMGPVAIDGRKPILDWGIRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLGDDFCPKISDFGLAKL

HMMPanther: PTHR24420:SF576
2-181 OS10G0101000 PROTEIN

RFTYAELKAATDGNPKFFAIGRGGFGDVYRGYLPDKRIVAIKCLKHVTGGDAEFWAEVTIIARMHHLNLSGYGAFCAEKGQRILVYEYVPNGSLDKYLFPAGQVASSGSEMEMGPVAIDGRKPILDWGIRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLGDDFCPKISDFGLAKL

HMMPanther: PTHR24420
2-181 FAMILY NOT NAMED,FAMILY NOT NAMED

RFTYAELKAATDGNPKFFAIGRGGFGDVYRGYLPDKRIVAIKCLKHVTGGDAEFWAEVTIIARMHHLNLSGYGAFCAEKGQRILVYEYVPNGSLDKYLFPAGQVASSGSEMEMGPVAIDGRKPILDWGIRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLGDDFCPKISDFGLAKL

Gene3D: G3DSA:3.30.200.20
2-75 no description

RFTYAELKAATDGNPKFFAIGRGGFGDVYRGYLPDKRIVAIKCLKHVTGGDAEFWAEVTIIARMHHLNLSGYGA

ProfileScan: PS50011
IPR000719
15-182 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

NPKFFAIGRGGFGDVYRGYLPDKRIVAIKCLKHVTGGDAEFWAEVTIIARMHHLNLSGYGAFCAEKGQRILVYEYVPNGSLDKYLFPAGQVASSGSEMEMGPVAIDGRKPILDWGIRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLGDDFCPKISDFGLAKLX

HMMSmart: SM00220
IPR002290
21-182 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

IGRGGFGDVYRGYLPDKRIVAIKCLKHVTGGDAEFWAEVTIIARMHHLNLSGYGAFCAEKGQRILVYEYVPNGSLDKYLFPAGQVASSGSEMEMGPVAIDGRKPILDWGIRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLGDDFCPKISDFGLAKLX

HMMSmart: SM00219
IPR020635
21-182 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

IGRGGFGDVYRGYLPDKRIVAIKCLKHVTGGDAEFWAEVTIIARMHHLNLSGYGAFCAEKGQRILVYEYVPNGSLDKYLFPAGQVASSGSEMEMGPVAIDGRKPILDWGIRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLGDDFCPKISDFGLAKLX

PatternScan: PS00107
IPR017441
21-43 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGRGGFGDVYRGYLPDKRIVAIK

HMMPfam: PF00069
IPR000719
21-180 Pkinase,Ser-thr
Protein kinase, catalytic domain

IGRGGFGDVYRGYLPDKRIVAIKCLKHVTGGDAEFWAEVTIIARMHHLNLSGYGAFCAEKGQRILVYEYVPNGSLDKYLFPAGQVASSGSEMEMGPVAIDGRKPILDWGIRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLGDDFCPKISDFGLAK

Gene3D: G3DSA:1.10.510.10
76-180 no description

FCAEKGQRILVYEYVPNGSLDKYLFPAGQVASSGSEMEMGPVAIDGRKPILDWGIRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLGDDFCPKISDFGLAK

PatternScan: PS00108
IPR008271
153-165 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHCDIKPENILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox