PRGDB00194128 (Mes.19637)

From PRG Wiki
Jump to: navigation, search
Mes.19637
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 117938451 (EF035081)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Manihot esculenta

Comment?

Manihot esculenta putative serine

DNA Sequence

CTATCTTCCAAATCCAGGCAAGGAAACCGTGAATTTGTGACTGAAATAGGAATGATATCTGGTTTAAGGCACCCAAATCTTGTAAAGCTTTATGGATGTTGTGTTGAAGGAAATCAGTTACTGCTGGTATACGAGTATATGGAAAACAATAGCCTGGCACATGCACTCTTTGATTCAGAAACAAGTTCTCTGATGTTGGACTGGGCAACAAGACAGAAGATTTGTGTAGGAATAGCCAGAGGTCTAGCATTTCTCCATGAAGAATCACCACTGAGGATCATCCATAGAGACATCAAAGCAACAAATGTCCTGCTTGATAGAGATCTGAATGCCAAGATATCGGATTTTGGACTAGCAAAGCTCTTTGAGGAGGATAATACTCACGTTAGCACCAGAATTGCAGGAACTATAGGATATATGGCTCCAGAATATGCACTCTGGGGTTATCTAACAGAAAAGGCAGATGTTTATAGCTTTGGGGTTGTTGCTCTGGAAATTGTCAGTGGAAGGTGCAATACCAGTTACAGGCCGAAAAATGATGCTGTTTGTCTTCTTGATTGGGCCTTCATTTTGCATCAGAGAGGAAATCTAATGGAGATAGTGGACCCAAGGTTGGGGTTTGAATTC


Protein sequences

Name Description Sequence
Mes.19637 translated coding region predicted by ESTScan from UniGene Mes.19637

LSSKSRQGNREFVTEIGMISGLRHPNLVKLYGCCVEGNQLLLVYEYMENNSLAHALFDSETSSLMLDWATRQKICVGIARGLAFLHEESPLRIIHRDIKATNVLLDRDLNAKISDFGLAKLFEEDNTHVSTRIAGTIGYMAPEYALWGYLTEKADVYSFGVVALEIVSGRCNTSYRPKNDAVCLLDWAFILHQRGNLMEIVDPRLGFEF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF696
1-209 PTHR24420:SF696

LSSKSRQGNREFVTEIGMISGLRHPNLVKLYGCCVEGNQLLLVYEYMENNSLAHALFDSETSSLMLDWATRQKICVGIARGLAFLHEESPLRIIHRDIKATNVLLDRDLNAKISDFGLAKLFEEDNTHVSTRIAGTIGYMAPEYALWGYLTEKADVYSFGVVALEIVSGRCNTSYRPKNDAVCLLDWAFILHQRGNLMEIVDPRLGFEF

ProfileScan: PS50011
IPR000719
1-209 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LSSKSRQGNREFVTEIGMISGLRHPNLVKLYGCCVEGNQLLLVYEYMENNSLAHALFDSETSSLMLDWATRQKICVGIARGLAFLHEESPLRIIHRDIKATNVLLDRDLNAKISDFGLAKLFEEDNTHVSTRIAGTIGYMAPEYALWGYLTEKADVYSFGVVALEIVSGRCNTSYRPKNDAVCLLDWAFILHQRGNLMEIVDPRLGFEF

HMMPanther: PTHR24420
1-209 PTHR24420,FAMILY NOT NAMED

LSSKSRQGNREFVTEIGMISGLRHPNLVKLYGCCVEGNQLLLVYEYMENNSLAHALFDSETSSLMLDWATRQKICVGIARGLAFLHEESPLRIIHRDIKATNVLLDRDLNAKISDFGLAKLFEEDNTHVSTRIAGTIGYMAPEYALWGYLTEKADVYSFGVVALEIVSGRCNTSYRPKNDAVCLLDWAFILHQRGNLMEIVDPRLGFEF

Gene3D: G3DSA:3.30.200.20
3-38 G3DSA:3.30.200.20

SKSRQGNREFVTEIGMISGLRHPNLVKLYGCCVEGN

superfamily: SSF56112
IPR011009
5-170 Kinase_like
Protein kinase-like domain

SRQGNREFVTEIGMISGLRHPNLVKLYGCCVEGNQLLLVYEYMENNSLAHALFDSETSSLMLDWATRQKICVGIARGLAFLHEESPLRIIHRDIKATNVLLDRDLNAKISDFGLAKLFEEDNTHVSTRIAGTIGYMAPEYALWGYLTEKADVYSFGVVALEIVSGR

HMMPfam: PF00069
IPR000719
6-174 Pkinase,Ser-thr
Protein kinase, catalytic domain

RQGNREFVTEIGMISGLRHPNLVKLYGCCVEGNQLLLVYEYMENNSLAHALFDSETSSLMLDWATRQKICVGIARGLAFLHEESPLRIIHRDIKATNVLLDRDLNAKISDFGLAKLFEEDNTHVSTRIAGTIGYMAPEYALWGYLTEKADVYSFGVVALEIVSGRCNTS

Gene3D: G3DSA:1.10.510.10
39-173 G3DSA:1.10.510.10

QLLLVYEYMENNSLAHALFDSETSSLMLDWATRQKICVGIARGLAFLHEESPLRIIHRDIKATNVLLDRDLNAKISDFGLAKLFEEDNTHVSTRIAGTIGYMAPEYALWGYLTEKADVYSFGVVALEIVSGRCNT

PatternScan: PS00108
IPR008271
93-105 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKATNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox