PRGDB00194129 (Ncr.30151)

From PRG Wiki
Jump to: navigation, search
Ncr.30151
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 213896767 (GH113604)
Gene Class Unknown
Domain Type
Gene Species Neurospora crassa

Comment?

G993P144RK13.T0 Neurospora crassa cDNA - 1 hour Glucose Deprivation After 9 hours Vegetative Growth Neurospora crassa cDNA, mRNA sequence

DNA Sequence

AGGCTCCGGTACCCTGGGTTGGGATCTCGTTGCCGCCAACCTGATCGAGCCTGGTGAGGATGCGCTCGTGCTCAGCACCGGTTACTTTGGCGATGGCTTCGCCGACTGCCTGAAGGTCTACGGCGCCAACGTCACCCAGATCTCTGCCGAGCCCGGCAGCCGCCCTCAGCTCCCTGAGATTGAGAAGGCTCTTTCGGAGAAGAAGTACAAGCTCCTCACCGTCACTCACGTCGATACCTCTACTGGTGTCCTCAGCGAGCTCAAGAACCTTTCCGAGCTTGTCCACAGGGTTTCCCCCGACACCCTCGTCATTGTCGATGGTGTCTGCTCCGTCGCCTGTGAGGAGATTGACTTTGATGCCTGGAAGCTCGACGGTGTTGTCACTGCCTCCCAGAAAGCCATCGGCTGCCCTGCCGGTCTCTCTATCTCCATGTTCAGCGGTCGCGCCATCCAGGCCTTCCAGAACCGCCAGACTCCACCGACCTCTTACTTTGCTTCAATGAAGAACTGGCTGCCCATCATGCAGAACTACGAGGGCCAGAAGCCCTCCTACTTCGCCACTCCTTCTCCCCAGCTCGATCGCGCCCTCCATACCGCCCTTGGCCAGATCGTCGCCCAGGGTGTCGAAGCAAGGTTCGCGTCCCACAAGGCGGCTTCGGATCAGAATCAAGGACGGCCGTTGCTGCTCTCGGTCTTCGAGCAGATCGCCGTCGACCCTGAATGACCAGGCCCAC


Protein sequences

Name Description Sequence
Ncr.30151 translated coding region predicted by ESTScan from UniGene Ncr.30151

XGSGTLGWDLVAANLIEPGEDALVLSTGYFGDGFADCLKVYGANVTQISAEPGSRPQLPEIEKALSEKKYKLLTVTHVDTSTGVLSELKNLSELVHRVSPDTLVIVDGVCSVACEEIDFDAWKLDGVVTASQKAIGCPAGLSISMFSGRAIQAFQNRQTPPTSYFASMKNWLPIMQNYEGQKPSYFATPSPQLDRALHTALGQIVAQGVEARFASHKAASDQNQGRPLLLSVFEQIAVDPEXPGPX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152
2-221 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

GSGTLGWDLVAANLIEPGEDALVLSTGYFGDGFADCLKVYGANVTQISAEPGSRPQLPEIEKALSEKKYKLLTVTHVDTSTGVLSELKNLSELVHRVSPDTLVIVDGVCSVACEEIDFDAWKLDGVVTASQKAIGCPAGLSISMFSGRAIQAFQNRQTPPTSYFASMKNWLPIMQNYEGQKPSYFATPSPQLDRALHTALGQIVAQGVEARFASHKAASD

Gene3D: G3DSA:3.40.640.10
IPR015421
2-204 no description
Pyridoxal phosphate-dependent transferase, major r

GSGTLGWDLVAANLIEPGEDALVLSTGYFGDGFADCLKVYGANVTQISAEPGSRPQLPEIEKALSEKKYKLLTVTHVDTSTGVLSELKNLSELVHRVSPDTLVIVDGVCSVACEEIDFDAWKLDGVVTASQKAIGCPAGLSISMFSGRAIQAFQNRQTPPTSYFASMKNWLPIMQNYEGQKPSYFATPSPQLDRALHTALGQI

superfamily: SSF53383
IPR015424
2-222 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

GSGTLGWDLVAANLIEPGEDALVLSTGYFGDGFADCLKVYGANVTQISAEPGSRPQLPEIEKALSEKKYKLLTVTHVDTSTGVLSELKNLSELVHRVSPDTLVIVDGVCSVACEEIDFDAWKLDGVVTASQKAIGCPAGLSISMFSGRAIQAFQNRQTPPTSYFASMKNWLPIMQNYEGQKPSYFATPSPQLDRALHTALGQIVAQGVEARFASHKAASDQ

HMMPanther: PTHR21152:SF7
2-221 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GSGTLGWDLVAANLIEPGEDALVLSTGYFGDGFADCLKVYGANVTQISAEPGSRPQLPEIEKALSEKKYKLLTVTHVDTSTGVLSELKNLSELVHRVSPDTLVIVDGVCSVACEEIDFDAWKLDGVVTASQKAIGCPAGLSISMFSGRAIQAFQNRQTPPTSYFASMKNWLPIMQNYEGQKPSYFATPSPQLDRALHTALGQIVAQGVEARFASHKAASD

HMMPfam: PF00266
IPR000192
4-220 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

GTLGWDLVAANLIEPGEDALVLSTGYFGDGFADCLKVYGANVTQISAEPGSRPQLPEIEKALSEKKYKLLTVTHVDTSTGVLSELKNLSELVHRVSPDTLVIVDGVCSVACEEIDFDAWKLDGVVTASQKAIGCPAGLSISMFSGRAIQAFQNRQTPPTSYFASMKNWLPIMQNYEGQKPSYFATPSPQLDRALHTALGQIVAQGVEARFASHKAAS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox