PRGDB00194160 (Ppa.19491)

From PRG Wiki
Jump to: navigation, search
Ppa.19491
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 208375368 (DC936967)
Gene Class Unknown
Domain Type LRR
Gene Species Physcomitrella patens

Comment?

DC936967 ppgs full-length cDNA library; green sporophytes Physcomitrella patens subsp. patens cDNA clone ppgs23n08 5', mRNA sequence

DNA Sequence

GTACCTGCTGGGCTCGGGGAAGAAGAAGAACAACAACAAGACCGAGACCTTCTTTTGATTGTGTGTGGAAGAAGAAGACCAGCATTATTATTGCAGCACAGCACAGCGCCACACAGATTTCACTCGCTGCACcgctttggggttgcttgctcgcttgcttgctcgcttgcttgcttgcatgcttgctgcagctgtgctttgctGAAAATGGAGAACTCAGGTGGAAGATTGGTTTTGTATGCATTGTTGGTTGGCGCTCTTCTACCTGCCGCACTTGCTAACTCTGAAGGAGATGCGCTGTATGCTCTCCGCCGGAGTTTGACTGATCCATCGAATGTGTTGCAAAGCTGGGATCCTACCTTGGTCAATCCTTGCACCTGGTTCCATGTGACGTGTGACGGCCAAAATCGAGTCATCCGAGTGGATCTTGGGAATGCTCGCCTGTCCGGCTCTTTGGTCTCTGAACTTGGAGCACTTCAGAACCTGCAGTACCTGGAGTTGTACAAGAACAGCCTCACTGGTCACATTCCCTCGGAACTTGGCAAGTTGAAGTCTCTCGTGAGTTTGGACTTGTACCACAACAATTTTACAGGCTCCATTCCTCGCTCTCTTGGAAAGCTATCCAATCTGGCATTTCTACGTCTGAACAATAACAAGCTGACTGGTCGTATTCCACGTGAATTGACGTCAATCACCACCCTCAAAGCTGTCGATTTTTCAAACATGACTTGTGCGGCACAATTCCGGTCACGGGCTCTTTCAGTCATCTTCANGCCAGAACTTGANACACCCTCGTCTGA


Protein sequences

Name Description Sequence
Ppa.19491 translated coding region predicted by ESTScan from UniGene Ppa.19491

VPAGLGEEEEQQQDRDLLLIVCGRRRPALLLQHSTAPHRFHSLHRFGVACSLACSLACLHACCSCALLKMENSGGRLVLYALLVGALLPAALANSEGDALYALRRSLTDPSNVLQSWDPTLVNPCTWFHVTCDGQNRVIRVDLGNARLSGSLVSELGALQNLQYLELYKNSLTGHIPSELGKLKSLVSLDLYHNNFTGSIPRSLGKLSNLAFLRLNNNKLTGRIPRELTSITTLKAVDFSNMTCAAQFRSRALSVIFXPELXTPSSX

Domains

Domain Start-End Description Sequence

Seg: seg
7-13 seg

EEEEQQQ

Seg: seg
49-68 seg

ACSLACSLACLHACCSCALL

HMMPanther: PTHR24420:SF836
59-241 SUBFAMILY NOT NAMED

LHACCSCALLKMENSGGRLVLYALLVGALLPAALANSEGDALYALRRSLTDPSNVLQSWDPTLVNPCTWFHVTCDGQNRVIRVDLGNARLSGSLVSELGALQNLQYLELYKNSLTGHIPSELGKLKSLVSLDLYHNNFTGSIPRSLGKLSNLAFLRLNNNKLTGRIPRELTSITTLKAVDFSN

HMMPanther: PTHR24420
59-241 FAMILY NOT NAMED,FAMILY NOT NAMED

LHACCSCALLKMENSGGRLVLYALLVGALLPAALANSEGDALYALRRSLTDPSNVLQSWDPTLVNPCTWFHVTCDGQNRVIRVDLGNARLSGSLVSELGALQNLQYLELYKNSLTGHIPSELGKLKSLVSLDLYHNNFTGSIPRSLGKLSNLAFLRLNNNKLTGRIPRELTSITTLKAVDFSN

Seg: seg
77-93 seg

LVLYALLVGALLPAALA

superfamily: SSF52058
90-241 L domain-like,LRR

AALANSEGDALYALRRSLTDPSNVLQSWDPTLVNPCTWFHVTCDGQNRVIRVDLGNARLSGSLVSELGALQNLQYLELYKNSLTGHIPSELGKLKSLVSLDLYHNNFTGSIPRSLGKLSNLAFLRLNNNKLTGRIPRELTSITTLKAVDFSN

HMMPfam: PF08263
IPR013210
93-133 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

ANSEGDALYALRRSLTDPSNVLQSWDPTLVNPCTWFHVTCD

Gene3D: G3DSA:3.80.10.10
95-242 no description

SEGDALYALRRSLTDPSNVLQSWDPTLVNPCTWFHVTCDGQNRVIRVDLGNARLSGSLVSELGALQNLQYLELYKNSLTGHIPSELGKLKSLVSLDLYHNNFTGSIPRSLGKLSNLAFLRLNNNKLTGRIPRELTSITTLKAVDFSNM

HMMPfam: PF12799
161-197 LRR_4,Leucine Rich repeats (2 copies)

NLQYLELYKNSLTGHIPSELGKLKSLVSLDLYHNNFT

HMMPfam: PF13504
208-222 LRR_7,Leucine rich repeat

SNLAFLRLNNNKLTG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox