PRGDB00203703 (Carubv10027991m)

From PRG Wiki
Jump to: navigation, search
Carubv10027991m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, RPW8, Others
Gene Species Capsella rubella

Comment?

DNA Sequence

ATGAACGATTGGGCTAGTTTGGGATTAGGTTCACTTGGGGGAGCTGTGTTTTCCGAGCTACTGAAATTTGTGATTGAAGAGGCAAAAAAGGTTAAAGCTTTCAAACCATTGTCCGAGGATCTCGTATCCACGATGGAGAGATTGCTTCCGTTAACTCAACAGATCGATTTGATGCAAAACGAGCTTGACCTAGGTGTGAAGGAACTTAAGGAACTAAGGGATACCATCGACAGAGCTCGTGTAGCTGTTGAGAATTTTCCAAAAGTCCGGTGGTTCGAGAAATCTAAATATACTGGAAAGATTATGAAAATCAATGAAGATCTGCTTAGTTTCTGTCAGATTGATCTTCAGCTTCTTCAGCATAGGAATCAGTTGAAACTGTTGGATCTGACGGGAAACCTTGCGACTTCGGTTGGCGTTTTAAGTAAGAGAATGGACGTCTTGAGTGTTCATGCGCCCGTCTTTAGGGACCTTTGTTCAGTTCCCAAGCTTGATAAGGTTATCATTGGATTGGATTGCCCTTTGATGGAGCTAAAAAGGAGACTCCTTGACAATTCCCTGGTTGGTATCGTGGTGTCTGCTCCTCCTGGGTGCGGGAAGACTACGCTGGTTACTCAGCTTTGCGACGATCCAGAGATCAAAAGAAACTTCAAGCATATCTTCTTCAATGTAGTATCAAGTACTCCTAACTTTAGAGTCATAGTACAGAATTTACTCCAGCACAACGGTTACGAAGCACTTACATTTGAGAACGATTCTCAAGCACTTGTTGGCTTAAGAAAACTGCTTGAGGAACTCAAAGAAACGGGTCCTATATTGTTGGTGTTGGATGATGTTTGGCGGGGAGCCGAGTCCTTGCTTCAAAAGTTTCAACTTAAATTACCCAATTATAAGATTTTGGTGACTTCTCGGTCTGACTTTCCGAGTTTTGGTTCCAATTATCATTTGAAACCTTTGGAAGATGAAGATGCCAAAGCCCTTCTCATTCAGTGGGCATCAAGACCTTATAACGTGTCTCCAGCTGAGTACGAAGATCTTCTCCAAAAGATATTAAAACGTTGCAATGGATTTCCAATCGTTATTGAAGTAGTCGGTGTTTCACTCAAAGGACGATCTCTAAGTACGTGGAGAGGCCAGGTGGAAAGCTGGTATGATGGGGAAACAATTCTTGGTAATCCTCTTCCTTCTGTGCTAGAATGTCTGCAGCCTAGTTTCGATGCTCTGGAATTCAATCTTAAAGAGTGTTTCTTAGACATGGGCTCATTTCTTGAGGACCAAAAGATACGTGCTTCGATAATAATAGACATATGGGTGGAATTATACGGTAAAGGTAGTACTTTGTGCATGAAGTACCTTGAAGACCTTGCCTCCCAGAATCTGCTTAAACTTGTTCCTCTCGGCAGAACAGATATAGAAGAAGGTTTCTACAATGAGTTCTTAGTCACTCAACATGATATCCTCAGGGAGTTGGCTATCTCTCAAAGTGAATTAAAGGAAATTGTGGAAAGAAAAAGAGTAAATTTGGTAATAAGGGAGGATATATTTCCAGACTGGTGTTTGAATCCAAGACACCCTACTATTAAGGCCTCATTATTGTCTATCTCTACAGGTGATTTGTTCTCATCGAATTGGGTTGAAATGGATTGCCCTAATGTTGAAGCTCTTGTTCTTAATATTTCTTCATCAGACTATGCCTTACCAAGCTTTATTGCCAGAATGACTAAGCTAAAGGTTTTGACAATCACAAATCACGGGTTTTATCCAGCAAGATTGAGAAATTTCATGTGTATCAGCTCATTACCAAACCTTAAAAGGATTAGATTGGAAAAAGTTTCAACCACATTGTTAGACATTCTCCAGTTGAAACTCGGCAATCTCAAGAAACTGTCTTTGGTCATGTGTAGTTTCAGTGAGGTTTTCTATGACATAGAAGAAATAGATGTCCCTAAAGTTTTACCGAGTTTACAGGAGATTGAGATAGACTACTGCTATGATCTTGATGAGTTACCATATTGGGTTTCCGAAATTGTTTCATTGAAGACACTTAGCATCACAAATTGTAACAAACTTTATACACTTCCAGAAGCTATAGGAAACTTGAGTAAACTGGAAACGTTGAGGTTGTGTTCTTGTATTAATCTTTCTGAGCTGCCTGAGGCCACGGAGAGACTCAGCAACTTACGGTTCCTGGATATATCTCATTGCTTAGGATTGAGAAAGTTGCCTCAAGAGATTGGCAAACTGCAGAAGCTGAGGAAGATCTCGATGAGGAAGTGTTCGGGATGCGAGTTGCCAGATTCAGTGAGGAATCTAGAGAATCTGGAGGTTAAATGCGATGAAGAAACTGGCTTCTTGTGGGAAAGGTTGAAGCCAAAAATGAGAAATTTGAGGGTTCACGAGGAGGAAACAGAGCATAACCTGAACTTGCTCAATCATATGTTTTAA


Protein sequences

Name Description Sequence
Carubv10027991m protein obtained from Pythozome database for gene Carubv10027991m

MNDWASLGLGSLGGAVFSELLKFVIEEAKKVKAFKPLSEDLVSTMERLLPLTQQIDLMQNELDLGVKELKELRDTIDRARVAVENFPKVRWFEKSKYTGKIMKINEDLLSFCQIDLQLLQHRNQLKLLDLTGNLATSVGVLSKRMDVLSVHAPVFRDLCSVPKLDKVIIGLDCPLMELKRRLLDNSLVGIVVSAPPGCGKTTLVTQLCDDPEIKRNFKHIFFNVVSSTPNFRVIVQNLLQHNGYEALTFENDSQALVGLRKLLEELKETGPILLVLDDVWRGAESLLQKFQLKLPNYKILVTSRSDFPSFGSNYHLKPLEDEDAKALLIQWASRPYNVSPAEYEDLLQKILKRCNGFPIVIEVVGVSLKGRSLSTWRGQVESWYDGETILGNPLPSVLECLQPSFDALEFNLKECFLDMGSFLEDQKIRASIIIDIWVELYGKGSTLCMKYLEDLASQNLLKLVPLGRTDIEEGFYNEFLVTQHDILRELAISQSELKEIVERKRVNLVIREDIFPDWCLNPRHPTIKASLLSISTGDLFSSNWVEMDCPNVEALVLNISSSDYALPSFIARMTKLKVLTITNHGFYPARLRNFMCISSLPNLKRIRLEKVSTTLLDILQLKLGNLKKLSLVMCSFSEVFYDIEEIDVPKVLPSLQEIEIDYCYDLDELPYWVSEIVSLKTLSITNCNKLYTLPEAIGNLSKLETLRLCSCINLSELPEATERLSNLRFLDISHCLGLRKLPQEIGKLQKLRKISMRKCSGCELPDSVRNLENLEVKCDEETGFLWERLKPKMRNLRVHEEETEHNLNLLNHMF*

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-150 RPW8
Powdery mildew resistance protein, RPW8 domain

MNDWASLGLGSLGGAVFSELLKFVIEEAKKVKAFKPLSEDLVSTMERLLPLTQQIDLMQNELDLGVKELKELRDTIDRARVAVENFPKVRWFEKSKYTGKIMKINEDLLSFCQIDLQLLQHRNQLKLLDLTGNLATSVGVLSKRMDVLSV

Seg: seg
6-14 seg

SLGLGSLGG

HMMPfam: PF05659
IPR008808
6-137 RPW8
Powdery mildew resistance protein, RPW8 domain

SLGLGSLGGAVFSELLKFVIEEAKKVKAFKPLSEDLVSTMERLLPLTQQIDLMQNELDLGVKELKELRDTIDRARVAVENFPKVRWFEKSKYTGKIMKINEDLLSFCQIDLQLLQHRNQLKLLDLTGNLATS

HMMPanther: PTHR23155:SF239
9-776 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

LGSLGGAVFSELLKFVIEEAKKVKAFKPLSEDLVSTMERLLPLTQQIDLMQNELDLGVKELKELRDTIDRARVAVENFPKVRWFEKSKYTGKIMKINEDLLSFCQIDLQLLQHRNQLKLLDLTGNLATSVGVLSKRMDVLSVHAPVFRDLCSVPKLDKVIIGLDCPLMELKRRLLDNSLVGIVVSAPPGCGKTTLVTQLCDDPEIKRNFKHIFFNVVSSTPNFRVIVQNLLQHNGYEALTFENDSQALVGLRKLLEELKETGPILLVLDDVWRGAESLLQKFQLKLPNYKILVTSRSDFPSFGSNYHLKPLEDEDAKALLIQWASRPYNVSPAEYEDLLQKILKRCNGFPIVIEVVGVSLKGRSLSTWRGQVESWYDGETILGNPLPSVLECLQPSFDALEFNLKECFLDMGSFLEDQKIRASIIIDIWVELYGKGSTLCMKYLEDLASQNLLKLVPLGRTDIEEGFYNEFLVTQHDILRELAISQSELKEIVERKRVNLVIREDIFPDWCLNPRHPTIKASLLSISTGDLFSSNWVEMDCPNVEALVLNISSSDYALPSFIARMTKLKVLTITNHGFYPARLRNFMCISSLPNLKRIRLEKVSTTLLDILQLKLGNLKKLSLVMCSFSEVFYDIEEIDVPKVLPSLQEIEIDYCYDLDELPYWVSEIVSLKTLSITNCNKLYTLPEAIGNLSKLETLRLCSCINLSELPEATERLSNLRFLDISHCLGLRKLPQEIGKLQKLRKISMRKCSGCELPDSVRNLENLEV

HMMPanther: PTHR23155
9-776 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LGSLGGAVFSELLKFVIEEAKKVKAFKPLSEDLVSTMERLLPLTQQIDLMQNELDLGVKELKELRDTIDRARVAVENFPKVRWFEKSKYTGKIMKINEDLLSFCQIDLQLLQHRNQLKLLDLTGNLATSVGVLSKRMDVLSVHAPVFRDLCSVPKLDKVIIGLDCPLMELKRRLLDNSLVGIVVSAPPGCGKTTLVTQLCDDPEIKRNFKHIFFNVVSSTPNFRVIVQNLLQHNGYEALTFENDSQALVGLRKLLEELKETGPILLVLDDVWRGAESLLQKFQLKLPNYKILVTSRSDFPSFGSNYHLKPLEDEDAKALLIQWASRPYNVSPAEYEDLLQKILKRCNGFPIVIEVVGVSLKGRSLSTWRGQVESWYDGETILGNPLPSVLECLQPSFDALEFNLKECFLDMGSFLEDQKIRASIIIDIWVELYGKGSTLCMKYLEDLASQNLLKLVPLGRTDIEEGFYNEFLVTQHDILRELAISQSELKEIVERKRVNLVIREDIFPDWCLNPRHPTIKASLLSISTGDLFSSNWVEMDCPNVEALVLNISSSDYALPSFIARMTKLKVLTITNHGFYPARLRNFMCISSLPNLKRIRLEKVSTTLLDILQLKLGNLKKLSLVMCSFSEVFYDIEEIDVPKVLPSLQEIEIDYCYDLDELPYWVSEIVSLKTLSITNCNKLYTLPEAIGNLSKLETLRLCSCINLSELPEATERLSNLRFLDISHCLGLRKLPQEIGKLQKLRKISMRKCSGCELPDSVRNLENLEV

Coil: coil
55-76 coiled-coil

IDLMQNELDLGVKELKELRDTI

superfamily: SSF52540
151-382 P-loop containing nucleoside triphosphate hydrolases

HAPVFRDLCSVPKLDKVIIGLDCPLMELKRRLLDNSLVGIVVSAPPGCGKTTLVTQLCDDPEIKRNFKHIFFNVVSSTPNFRVIVQNLLQHNGYEALTFENDSQALVGLRKLLEELKETGPILLVLDDVWRGAESLLQKFQLKLPNYKILVTSRSDFPSFGSNYHLKPLEDEDAKALLIQWASRPYNVSPAEYEDLLQKILKRCNGFPIVIEVVGVSLKGRSLSTWRGQVES

Gene3D: G3DSA:3.40.50.300
168-285 no description

IIGLDCPLMELKRRLLDNSLVGIVVSAPPGCGKTTLVTQLCDDPEIKRNFKHIFFNVVSSTPNFRVIVQNLLQHNGYEALTFENDSQALVGLRKLLEELKETGPILLVLDDVWRGAES

HMMPfam: PF00931
IPR002182
180-439 NB-ARC,NBS
NB-ARC

RRLLDNSLVGIVVSAPPGCGKTTLVTQLCDDPEIKRNFKHIFFNVVSSTPNFRVIVQNLLQHNGYEALTFENDSQALVGLRKLLEELKETGPILLVLDDVWRGAESLLQKFQLKLPNYKILVTSRSDFPSFGSNYHLKPLEDEDAKALLIQWASRPYNVSPAEYEDLLQKILKRCNGFPIVIEVVGVSLKGRSLSTWRGQVESWYDGETILGNPLPSVLECLQPSFDALEFNLKECFLDMGSFLEDQKIRASIIIDIWVE

FPrintScan: PR00364
IPR000767
189-204 DISEASERSIST
Disease resistance protein

GIVVSAPPGCGKTTLV

FPrintScan: PR00364
IPR000767
266-280 DISEASERSIST
Disease resistance protein

LKETGPILLVLDDVW

FPrintScan: PR00364
IPR000767
354-368 DISEASERSIST
Disease resistance protein

CNGFPIVIEVVGVSL

Gene3D: G3DSA:3.80.10.10
530-775 no description

SLLSISTGDLFSSNWVEMDCPNVEALVLNISSSDYALPSFIARMTKLKVLTITNHGFYPARLRNFMCISSLPNLKRIRLEKVSTTLLDILQLKLGNLKKLSLVMCSFSEVFYDIEEIDVPKVLPSLQEIEIDYCYDLDELPYWVSEIVSLKTLSITNCNKLYTLPEAIGNLSKLETLRLCSCINLSELPEATERLSNLRFLDISHCLGLRKLPQEIGKLQKLRKISMRKCSGCELPDSVRNLENLE

superfamily: SSF52047
549-776 RNI-like,LRR

CPNVEALVLNISSSDYALPSFIARMTKLKVLTITNHGFYPARLRNFMCISSLPNLKRIRLEKVSTTLLDILQLKLGNLKKLSLVMCSFSEVFYDIEEIDVPKVLPSLQEIEIDYCYDLDELPYWVSEIVSLKTLSITNCNKLYTLPEAIGNLSKLETLRLCSCINLSELPEATERLSNLRFLDISHCLGLRKLPQEIGKLQKLRKISMRKCSGCELPDSVRNLENLEV

FPrintScan: PR00364
IPR000767
722-738 DISEASERSIST
Disease resistance protein

ERLSNLRFLDISHCLGL

HMMPfam: PF00560
IPR001611
726-748 LRR_1
Leucine-rich repeat

NLRFLDISHCLGLRKLPQEIGKL

Seg: seg
799-812 seg

HEEETEHNLNLLNH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox