PRGDB00203824 (Carubv10028383m)

From PRG Wiki
Jump to: navigation, search
Carubv10028383m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RPW8-NL
Domain Type NBS, LRR, RPW8, Others
Gene Species Capsella rubella

Comment?

DNA Sequence

ATGGCAGAAGCTATTGGCATAGAAGTTGTAAAAGAGCTGGTGAAGCAGCTCTATGCGGTATCTAAGAAAGCCTACATGTGTAAAGACATTGCCAAGAATCTTGCCACCACAATCGATGATTTGCAACCCACGATACAGGAGATCATGGATAGCAGCGGCGAGTCGAGCCAACATCGCCAAGATCAACTGCGTATGTTCTTCGACAACCTTGAGGAATGCAGGATGCTCACAGAAAAGGTTCTGAAATGTAAACGCTGGAACTTTGTTCGACAGATCAACTACGTCAAGAAAATGGAAGATCTCGACAGGAAAATCTATAGATTTTCTCAAGGAATAGTGCCTCTCCACACTCTCGCTGACGTTCGTCATCTCCGTGGGGCTGTAGATCGAATGAGCAAGAACGTCCATAGGAATGAGCAGGTGACTAAGGCTCGTATATTTGCTTATGGTGATAATTCTACAGCGCGCCTGGATCAGATAGAAAAATTTCTTGATATCTTAATTGATAGAATCACTTCTTTGAAAATCAATATATTTAATTTGAGCGAGGGGAAGGGGAAGGTGAAGAAGATGTTGTTTAAATCCACTGATGAGGAAAGACTTATTGGGATCTCAGGGATGAGTGGTTCAGGGAAAACCACTCTTGCCAGAGAGATTGAGCGGGACGAGGAGGTTCGAGGCCACTTTGGGAATAAGGTTTTGTTTCTGACTGTATCACAATCTCCCAATCTTGAGAAGCTGAGGTCCCTTATATTGGAATTTCTTACTGATAATGAGGCTGGCTCTGGTGCCATTCTTCCGGTTTCGATTGGTCAAACACGGAAGTTAGTGATCCTTGATGATGTCTGGACAAGGGAATCTCTGGAGCAACTGATGTTTGAAAATTTTCCTGGAACCACTACTCTTGTGGTCTCACGTTCTAAACTCGCAGGTCCAAGAATGACCTATGATGTAGAGTTACTCGATGAACACGACGCAATGACTCTACTTTGTCTCTCTGCTTTTGACCAGAAATCAGTCCCTTCTGGGTTAAGCAGAAGTTTGGTCAAGCAGGTTGTTGACGAGTGTAAAGGTCTACCTTTGTCTCTCAAAGTCATTGGCGCTTCATTAAAAGGCCGACCTGAAAAATATTGGCAAGGTGCAGTGAACAGGTTATCAAGAGGTGAACCTGCTGATATAAACCACGAGACTATAGTGTTTGCTCAAATCGAAGCAAGTCTCGAAATTCTCGATAAAAAATCCAGAGAGTGTTTCTTGGATCTTGGTGCTTTTCCTGAAGACAAAAAAATCCCTCTTGGTGTTATCATCAACATGTGGGTTGAACTACATGATATGGACGAGGAAACTGCTTTTTCAATTCTTATGGATTTAGCAGACAAGAATCTCCTTACTCTCGTGAAAGATCCAAGGTTCGGCGCTTTGTACACTGGCTACCATGACGTATTTGTAACGCAGCACGATGTTCTAAGAGATGTAGCACTTCTTCTTAGTAGTTTTGGGAAAGTAAATAGTAGAAAGCGGTTATCCATGCCGCAAAGAGCGTTGACGCTCCCTAGAGAATGGGAAAGGAGCAATGATGAACCATACAATGCACGTGTAGTTTCCATTCACACAGGCGAAATGAATGAAATGGATTGGTTTGACATGGAACTCCCCAAGACAGAAGTTCTGATTATAAACTTCTCCTCAGACAACTATGTATTGCCACCTTTTATTGCTAAGATGGGCAGGCTTAAGGCGCTCTTAGTTATCAACAATGGTCTGTTTCATGTCCGTCTACAAGACTTCTCCAGTTTTACAAATTTGGCTAAACTGCGAAGTCTATGGCTCCAGATGGTTTACGTACCCTACAGTACAATCACACTGAAGCACCTCCAAAAGCTGTCTCTAATCTTCTGCAAGAGTGTTAATCAAAAAGCACTCGACATGAACCTAATCTTCCCAAACTTATCCGATATCACAATAGATCATTGTGAGGATCTGGTTGAACTACCTTCGACCATCTCCGGGATCACCTCTCTCAACTCCATAAGCATAACAAACTGTCCTTCCATTGGTGAATTGCCTAATAATATGAGTAAGCTAATGGCCCTTGAACTTCTAAGGCTATACGCTTGCCCGGAGCTGAAGAGTCTACCTGAAGAAATCTGTGAGCTGCCGAATCTGAAATACATTGACATCTCTCAATGCGTCAACCTTAGTTGTCTTCCAGAAGAGGTTGGAAAGCTAAGCAGGCTTGAGAAAATTGACATGAGAGCATGTCCTTTACTGAGCATACCGAGCTCTGCGGTTAAATTGACTTCCTTGTGCCATGTAATTTGCGACAAGGAGAATTTGTGTATGTGGGAAAAGATTGAGAATGCAGTTCCAGGGCTTCGTGTGGAAGCCACAGAGGATTGCCTGGATTGA


Protein sequences

Name Description Sequence
Carubv10028383m protein obtained from Pythozome database for gene Carubv10028383m

MAEAIGIEVVKELVKQLYAVSKKAYMCKDIAKNLATTIDDLQPTIQEIMDSSGESSQHRQDQLRMFFDNLEECRMLTEKVLKCKRWNFVRQINYVKKMEDLDRKIYRFSQGIVPLHTLADVRHLRGAVDRMSKNVHRNEQVTKARIFAYGDNSTARLDQIEKFLDILIDRITSLKINIFNLSEGKGKVKKMLFKSTDEERLIGISGMSGSGKTTLAREIERDEEVRGHFGNKVLFLTVSQSPNLEKLRSLILEFLTDNEAGSGAILPVSIGQTRKLVILDDVWTRESLEQLMFENFPGTTTLVVSRSKLAGPRMTYDVELLDEHDAMTLLCLSAFDQKSVPSGLSRSLVKQVVDECKGLPLSLKVIGASLKGRPEKYWQGAVNRLSRGEPADINHETIVFAQIEASLEILDKKSRECFLDLGAFPEDKKIPLGVIINMWVELHDMDEETAFSILMDLADKNLLTLVKDPRFGALYTGYHDVFVTQHDVLRDVALLLSSFGKVNSRKRLSMPQRALTLPREWERSNDEPYNARVVSIHTGEMNEMDWFDMELPKTEVLIINFSSDNYVLPPFIAKMGRLKALLVINNGLFHVRLQDFSSFTNLAKLRSLWLQMVYVPYSTITLKHLQKLSLIFCKSVNQKALDMNLIFPNLSDITIDHCEDLVELPSTISGITSLNSISITNCPSIGELPNNMSKLMALELLRLYACPELKSLPEEICELPNLKYIDISQCVNLSCLPEEVGKLSRLEKIDMRACPLLSIPSSAVKLTSLCHVICDKENLCMWEKIENAVPGLRVEATEDCLD*

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-147 RPW8
Powdery mildew resistance protein, RPW8 domain

MAEAIGIEVVKELVKQLYAVSKKAYMCKDIAKNLATTIDDLQPTIQEIMDSSGESSQHRQDQLRMFFDNLEECRMLTEKVLKCKRWNFVRQINYVKKMEDLDRKIYRFSQGIVPLHTLADVRHLRGAVDRMSKNVHRNEQVTKARIF

HMMPfam: PF05659
IPR008808
4-135 RPW8
Powdery mildew resistance protein, RPW8 domain

AIGIEVVKELVKQLYAVSKKAYMCKDIAKNLATTIDDLQPTIQEIMDSSGESSQHRQDQLRMFFDNLEECRMLTEKVLKCKRWNFVRQINYVKKMEDLDRKIYRFSQGIVPLHTLADVRHLRGAVDRMSKNV

HMMPanther: PTHR23155:SF282
48-775 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IMDSSGESSQHRQDQLRMFFDNLEECRMLTEKVLKCKRWNFVRQINYVKKMEDLDRKIYRFSQGIVPLHTLADVRHLRGAVDRMSKNVHRNEQVTKARIFAYGDNSTARLDQIEKFLDILIDRITSLKINIFNLSEGKGKVKKMLFKSTDEERLIGISGMSGSGKTTLAREIERDEEVRGHFGNKVLFLTVSQSPNLEKLRSLILEFLTDNEAGSGAILPVSIGQTRKLVILDDVWTRESLEQLMFENFPGTTTLVVSRSKLAGPRMTYDVELLDEHDAMTLLCLSAFDQKSVPSGLSRSLVKQVVDECKGLPLSLKVIGASLKGRPEKYWQGAVNRLSRGEPADINHETIVFAQIEASLEILDKKSRECFLDLGAFPEDKKIPLGVIINMWVELHDMDEETAFSILMDLADKNLLTLVKDPRFGALYTGYHDVFVTQHDVLRDVALLLSSFGKVNSRKRLSMPQRALTLPREWERSNDEPYNARVVSIHTGEMNEMDWFDMELPKTEVLIINFSSDNYVLPPFIAKMGRLKALLVINNGLFHVRLQDFSSFTNLAKLRSLWLQMVYVPYSTITLKHLQKLSLIFCKSVNQKALDMNLIFPNLSDITIDHCEDLVELPSTISGITSLNSISITNCPSIGELPNNMSKLMALELLRLYACPELKSLPEEICELPNLKYIDISQCVNLSCLPEEVGKLSRLEKIDMRACPLLSIPSSAVKLTSLCHVICD

HMMPanther: PTHR23155
48-775 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IMDSSGESSQHRQDQLRMFFDNLEECRMLTEKVLKCKRWNFVRQINYVKKMEDLDRKIYRFSQGIVPLHTLADVRHLRGAVDRMSKNVHRNEQVTKARIFAYGDNSTARLDQIEKFLDILIDRITSLKINIFNLSEGKGKVKKMLFKSTDEERLIGISGMSGSGKTTLAREIERDEEVRGHFGNKVLFLTVSQSPNLEKLRSLILEFLTDNEAGSGAILPVSIGQTRKLVILDDVWTRESLEQLMFENFPGTTTLVVSRSKLAGPRMTYDVELLDEHDAMTLLCLSAFDQKSVPSGLSRSLVKQVVDECKGLPLSLKVIGASLKGRPEKYWQGAVNRLSRGEPADINHETIVFAQIEASLEILDKKSRECFLDLGAFPEDKKIPLGVIINMWVELHDMDEETAFSILMDLADKNLLTLVKDPRFGALYTGYHDVFVTQHDVLRDVALLLSSFGKVNSRKRLSMPQRALTLPREWERSNDEPYNARVVSIHTGEMNEMDWFDMELPKTEVLIINFSSDNYVLPPFIAKMGRLKALLVINNGLFHVRLQDFSSFTNLAKLRSLWLQMVYVPYSTITLKHLQKLSLIFCKSVNQKALDMNLIFPNLSDITIDHCEDLVELPSTISGITSLNSISITNCPSIGELPNNMSKLMALELLRLYACPELKSLPEEICELPNLKYIDISQCVNLSCLPEEVGKLSRLEKIDMRACPLLSIPSSAVKLTSLCHVICD

HMMPfam: PF00931
IPR002182
186-441 NB-ARC,NBS
NB-ARC

GKVKKMLFKSTDEERLIGISGMSGSGKTTLAREIERDEEVRGHFGNKVLFLTVSQSPNLEKLRSLILEFLTDNEAGSGAILPVSIGQTRKLVILDDVWTRESLEQLMFENFPGTTTLVVSRSKLAGPRMTYDVELLDEHDAMTLLCLSAFDQKSVPSGLSRSLVKQVVDECKGLPLSLKVIGASLKGRPEKYWQGAVNRLSRGEPADINHETIVFAQIEASLEILDKKSRECFLDLGAFPEDKKIPLGVIINMWVE

Gene3D: G3DSA:3.40.50.300
196-221 no description

TDEERLIGISGMSGSGKTTLAREIER

superfamily: SSF52540
197-393 P-loop containing nucleoside triphosphate hydrolases

DEERLIGISGMSGSGKTTLAREIERDEEVRGHFGNKVLFLTVSQSPNLEKLRSLILEFLTDNEAGSGAILPVSIGQTRKLVILDDVWTRESLEQLMFENFPGTTTLVVSRSKLAGPRMTYDVELLDEHDAMTLLCLSAFDQKSVPSGLSRSLVKQVVDECKGLPLSLKVIGASLKGRPEKYWQGAVNRLSRGEPADI

FPrintScan: PR00364
IPR000767
201-216 DISEASERSIST
Disease resistance protein

LIGISGMSGSGKTTLA

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

SIGQTRKLVILDDVW

FPrintScan: PR00364
IPR000767
356-370 DISEASERSIST
Disease resistance protein

CKGLPLSLKVIGASL

superfamily: SSF52058
504-780 L domain-like,LRR

SRKRLSMPQRALTLPREWERSNDEPYNARVVSIHTGEMNEMDWFDMELPKTEVLIINFSSDNYVLPPFIAKMGRLKALLVINNGLFHVRLQDFSSFTNLAKLRSLWLQMVYVPYSTITLKHLQKLSLIFCKSVNQKALDMNLIFPNLSDITIDHCEDLVELPSTISGITSLNSISITNCPSIGELPNNMSKLMALELLRLYACPELKSLPEEICELPNLKYIDISQCVNLSCLPEEVGKLSRLEKIDMRACPLLSIPSSAVKLTSLCHVICDKENLC

Gene3D: G3DSA:3.80.10.10
552-775 no description

PKTEVLIINFSSDNYVLPPFIAKMGRLKALLVINNGLFHVRLQDFSSFTNLAKLRSLWLQMVYVPYSTITLKHLQKLSLIFCKSVNQKALDMNLIFPNLSDITIDHCEDLVELPSTISGITSLNSISITNCPSIGELPNNMSKLMALELLRLYACPELKSLPEEICELPNLKYIDISQCVNLSCLPEEVGKLSRLEKIDMRACPLLSIPSSAVKLTSLCHVICD

FPrintScan: PR00364
IPR000767
717-733 DISEASERSIST
Disease resistance protein

CELPNLKYIDISQCVNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox