PRGDB00206976 (Aquca_023_00025.1)

From PRG Wiki
Jump to: navigation, search
Aquca_023_00025.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia coerulea

Comment?

DNA Sequence

ATGCTATTAGCAATTCCCTCCTCCATCTTCTTGTTTCTCCACCTTTTCTTGTTTCCTATTTCTTATGCAAACATACCCTTAGGTTCAACTCTCACACCTGTTTCCACTCCTAACAACAACTCAATAAACTGGACTTCACCCAACAATACTTACTCTCTTAGTTTCATTCCCATTGCTTCTTCTTATTCTGCTGCTATTTCCTTTTCTGGAATCCCAGTATGGAAAGCTGGTGGAGATGCTGGTATTGTTGACTCTTCAGCTCGTTTTGAACTTCTTCTTAATGGTAATCTTCGCTTAACTAATGGTTCTGGGGGTGTAGTTTGGGAATCTAACACACCGAATCGAGGAGTTACTACTGCACTACTTGATGATTCAGGTAATTTGTCTTTGAGAAATGGGTCAATCATTGTTTGGTCTACTTTTCAGAATCCAACTGATACCATCTTGCCTAATCAAAGTTTTACAACTTCAATGAGATTACAATCTGGTTCTTATTCATTTAGTTTACTTGATGTTGGTAATCTTAGTCTTAGATGGAACACAGATACCATTTATTGGAATCAAGCTCTTAATTCTTCTTTTAATGGGAATTTATCTTCCCCAACTTTGCGTTTTCAACAAATTGGAATTATACAGCTTTCTGATCCTACATTATCTGTTCCTGTTAATATGGCTTATAGTAGTGATTATGGTGAAGGGACTGATATTTTTAGATATTTAAGACTTGATTCTGATGGCAATTTAAGGATATATAGTTCTGATAGAGGTAGCGGTACTTCTACGGAAAGATGGGCAGCTGTTTTAGATCAATGTAGAGTTTATGGATGGTGTGGTAATATGGGTATTTGTAGTTACAACGACTCAACACCTGTTTGTGGTTGTCCTTCGCTGAATTTTGAGCTTTCCGATCCTAGTGATAGTAAAAAGGGGTGTAGGAGAAAGATGGAAATTGAAGATTGCCCAAGTAGTACTACTATGCTGCAATTAGAGCATACAGAATTTCTTACTTATCCACCAGAGCTTTCTTCTCAGATTTTCTTTGTTGGAATTTCGGCTTGTAGGTTAAATTGCCTTGTGGGAAGTTCATGTGTTGCTTCTACCTCCTTGGCTGATGGCACTGGCCAGTGTTACCTCAAAGGGTCGACTGTCATTAGCGGGTATCAGTCCCCAGCTCTGCCGAGTACTTCTTATATTAAGGTTTGCGGTCCAGTGCAACCTAATCCGTCGTCTACATCTACTGTGAACAACAATCAAAGTAGTTCAAAGAAACTACCAGCTTGGGTTGTTGGTGTTGTTGTTGTGAGTACTCTGGTGGGTTTGGTCCTTTTGGAGGTTGGGCTCTGGTTTTGGTGCTGCAGGAATAGCCCCAAATTTGGGGGACTATCAGCACAATATGCTCTTCTCGAGTATGCATCAGGTGCTCCTGTTCAGTTCTCGTACAAGGAGCTTCAACGTTCAACCAAGGGCTTTAAGGAAAAGCTTGGAGCCGGAGGTTTTGGGGCTGTCTATCGAGGTGTTCTTGCCAATAGGACTGTCGTTGCAGTCAAACAGCTAGAAGGAATTGAGCAAGGAGAAAAACAGTTCAGGATGGAGGTTGCTACTATAAGCAGTACACACCACTTAAATTTGGTGAGGTTGATTGGTTTTTGCTCTGAAGGTCGACACAGATTACTCGTTTATGAATTCATGAAGAATGGATCGTTGGATGATTTCCTGTTTGTTAAGGAGGACGCATCAGGGAAATTGTTAGACTGGGAAACTCGATTTAATGTAGCACTTGGGACTGCAAGGGGGATCACATATCTTCATGAGGAATGTCGAGATTGCATTGTTCACTGCGATATAAAACCAGAAAACATACTCTTGGATGACAACTTTAATGCTAAAGTTTGTGATTTTGGCTTGGCAAAGCTCATCAATTCAAAAGACCATCGATACCGAACCTTAACAAGTGTAAGGGGAACCAGAGGATACTTGGCGCCTGAATGGCTGGCTAACCTTCCAATAACATCCAAGTCTGATATCTACAGCTACGGCATGTTGCTGTTGGAAATAGTAAGTGGGCGGAGGAACTTTGATGTATCTGCAGAAACAAGTGGAAAAAGGTTTTCAATTTGGGCATACGAAGAGTTTGAGAAGGGAAACATCAATTGCATTGTTGATAAAAGACTGGCTGAGCATGAAGTAGACATGGAACAAGCAATCAGAGCTATAATGGTGAGCTTTTGGTGCATCCAAGAGCAACCATCACAGAGGCCTACAATGGGAAAAGTCGTGCAAATGCTAGAAGGAATTACAGCAATTGGTAAGCCTCCTGTCCCAAAAGTCATGATAGACACCTCCCTGGGTGGCACCAGTAGTGGAAATGTCAGCAGCAGTATCAGTGCTCTCTCCACCTTCGCGACTTCAGCTCCAGCACCATCTTCGTCATCATCATCCTCCCTTCAGTTGGGGGCTATATCTTCTGTCTCAGATAGCAATCTTAAAACAACACCATCTTTTATTTGA


Protein sequences

Name Description Sequence
Aquca_023_00025.1 protein obtained from Pythozome database for gene Aquca_023_00025.1

MLLAIPSSIFLFLHLFLFPISYANIPLGSTLTPVSTPNNNSINWTSPNNTYSLSFIPIASSYSAAISFSGIPVWKAGGDAGIVDSSARFELLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSIIVWSTFQNPTDTILPNQSFTTSMRLQSGSYSFSLLDVGNLSLRWNTDTIYWNQALNSSFNGNLSSPTLRFQQIGIIQLSDPTLSVPVNMAYSSDYGEGTDIFRYLRLDSDGNLRIYSSDRGSGTSTERWAAVLDQCRVYGWCGNMGICSYNDSTPVCGCPSLNFELSDPSDSKKGCRRKMEIEDCPSSTTMLQLEHTEFLTYPPELSSQIFFVGISACRLNCLVGSSCVASTSLADGTGQCYLKGSTVISGYQSPALPSTSYIKVCGPVQPNPSSTSTVNNNQSSSKKLPAWVVGVVVVSTLVGLVLLEVGLWFWCCRNSPKFGGLSAQYALLEYASGAPVQFSYKELQRSTKGFKEKLGAGGFGAVYRGVLANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSEGRHRLLVYEFMKNGSLDDFLFVKEDASGKLLDWETRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDDNFNAKVCDFGLAKLINSKDHRYRTLTSVRGTRGYLAPEWLANLPITSKSDIYSYGMLLLEIVSGRRNFDVSAETSGKRFSIWAYEEFEKGNINCIVDKRLAEHEVDMEQAIRAIMVSFWCIQEQPSQRPTMGKVVQMLEGITAIGKPPVPKVMIDTSLGGTSSGNVSSSISALSTFATSAPAPSSSSSSSLQLGAISSVSDSNLKTTPSFI*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF814
1-832 SUBFAMILY NOT NAMED

MLLAIPSSIFLFLHLFLFPISYANIPLGSTLTPVSTPNNNSINWTSPNNTYSLSFIPIASSYSAAISFSGIPVWKAGGDAGIVDSSARFELLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSIIVWSTFQNPTDTILPNQSFTTSMRLQSGSYSFSLLDVGNLSLRWNTDTIYWNQALNSSFNGNLSSPTLRFQQIGIIQLSDPTLSVPVNMAYSSDYGEGTDIFRYLRLDSDGNLRIYSSDRGSGTSTERWAAVLDQCRVYGWCGNMGICSYNDSTPVCGCPSLNFELSDPSDSKKGCRRKMEIEDCPSSTTMLQLEHTEFLTYPPELSSQIFFVGISACRLNCLVGSSCVASTSLADGTGQCYLKGSTVISGYQSPALPSTSYIKVCGPVQPNPSSTSTVNNNQSSSKKLPAWVVGVVVVSTLVGLVLLEVGLWFWCCRNSPKFGGLSAQYALLEYASGAPVQFSYKELQRSTKGFKEKLGAGGFGAVYRGVLANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSEGRHRLLVYEFMKNGSLDDFLFVKEDASGKLLDWETRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDDNFNAKVCDFGLAKLINSKDHRYRTLTSVRGTRGYLAPEWLANLPITSKSDIYSYGMLLLEIVSGRRNFDVSAETSGKRFSIWAYEEFEKGNINCIVDKRLAEHEVDMEQAIRAIMVSFWCIQEQPSQRPTMGKVVQMLEGITAIGKPPVPKVMIDTSLGGTSSGNVSSSISALSTFATSAPAPSSSSSSSLQLGAISSVSDSNLKTTP

HMMPanther: PTHR24420
1-832 FAMILY NOT NAMED,FAMILY NOT NAMED

MLLAIPSSIFLFLHLFLFPISYANIPLGSTLTPVSTPNNNSINWTSPNNTYSLSFIPIASSYSAAISFSGIPVWKAGGDAGIVDSSARFELLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSIIVWSTFQNPTDTILPNQSFTTSMRLQSGSYSFSLLDVGNLSLRWNTDTIYWNQALNSSFNGNLSSPTLRFQQIGIIQLSDPTLSVPVNMAYSSDYGEGTDIFRYLRLDSDGNLRIYSSDRGSGTSTERWAAVLDQCRVYGWCGNMGICSYNDSTPVCGCPSLNFELSDPSDSKKGCRRKMEIEDCPSSTTMLQLEHTEFLTYPPELSSQIFFVGISACRLNCLVGSSCVASTSLADGTGQCYLKGSTVISGYQSPALPSTSYIKVCGPVQPNPSSTSTVNNNQSSSKKLPAWVVGVVVVSTLVGLVLLEVGLWFWCCRNSPKFGGLSAQYALLEYASGAPVQFSYKELQRSTKGFKEKLGAGGFGAVYRGVLANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSEGRHRLLVYEFMKNGSLDDFLFVKEDASGKLLDWETRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDDNFNAKVCDFGLAKLINSKDHRYRTLTSVRGTRGYLAPEWLANLPITSKSDIYSYGMLLLEIVSGRRNFDVSAETSGKRFSIWAYEEFEKGNINCIVDKRLAEHEVDMEQAIRAIMVSFWCIQEQPSQRPTMGKVVQMLEGITAIGKPPVPKVMIDTSLGGTSSGNVSSSISALSTFATSAPAPSSSSSSSLQLGAISSVSDSNLKTTP

Seg: seg
10-18 seg

FLFLHLFLF

ProfileScan: PS50927
IPR001480
28-143 BULB_LECTIN
Bulb-type lectin domain

GSTLTPVSTPNNNSINWTSPNNTYSLSFIPIASSYSAAISFSGIPVWKAGGDAGIVDSSARFELLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSIIVWSTFQN

HMMSmart: SM00108
IPR001480
35-144 Bulb-type mannose-specific lectin
Bulb-type lectin domain

STPNNNSINWTSPNNTYSLSFIPIASSYSAAISFSGIPVWKAGGDAGIVDSSARFELLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSIIVWSTFQNP

Seg: seg
35-50 seg

STPNNNSINWTSPNNT

Seg: seg
54-69 seg

SFIPIASSYSAAISFS

superfamily: SSF51110
IPR001480
66-194 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

ISFSGIPVWKAGGDAGIVDSSARFELLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSIIVWSTFQNPTDTILPNQSFTTSMRLQSGSYSFSLLDVGNLSLRWNTDTIYWNQALNSSF

HMMPfam: PF01453
IPR001480
72-156 B_lectin
Bulb-type lectin domain

PVWKAGGDAGIVDSSARFELLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSIIVWSTFQNPTDTILPNQSFTT

Gene3D: G3DSA:2.90.10.10
IPR001480
73-189 no description
Bulb-type lectin domain

VWKAGGDAGIVDSSARFELLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSIIVWSTFQNPTDTILPNQSFTTSMRLQSGSYSFSLLDVGNLSLRWNTDTIYWNQA

Seg: seg
91-105 seg

LLLNGNLRLTNGSGG

ProfileScan: PS50927
IPR001480
145-263 BULB_LECTIN
Bulb-type lectin domain

TDTILPNQSFTTSMRLQSGSYSFSLLDVGNLSLRWNTDTIYWNQALNSSFNGNLSSPTLRFQQIGIIQLSDPTLSVPVNMAYSSDYGEGTDIFRYLRLDSDGNLRIYSSDRGSGTSTER

HMMPfam: PF00954
IPR000858
233-294 S_locus_glycop
S-locus glycoprotein

GTDIFRYLRLDSDGNLRIYSSDRGSGTSTERWAAVLDQCRVYGWCGNMGICSYNDSTPVCGC

Seg: seg
405-421 seg

QPNPSSTSTVNNNQSSS

Seg: seg
428-447 seg

VVGVVVVSTLVGLVLLEVGL

Gene3D: G3DSA:3.30.200.20
474-563 no description

APVQFSYKELQRSTKGFKEKLGAGGFGAVYRGVLANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSEGRHRLLVYEFM

superfamily: SSF56112
IPR011009
476-787 Protein kinase-like (PK-like)
Protein kinase-like domain

VQFSYKELQRSTKGFKEKLGAGGFGAVYRGVLANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSEGRHRLLVYEFMKNGSLDDFLFVKEDASGKLLDWETRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDDNFNAKVCDFGLAKLINSKDHRYRTLTSVRGTRGYLAPEWLANLPITSKSDIYSYGMLLLEIVSGRRNFDVSAETSGKRFSIWAYEEFEKGNINCIVDKRLAEHEVDMEQAIRAIMVSFWCIQEQPSQRPTMGKVVQMLEGITAIGKPPVPKVMIDTSLGGTSS

ProfileScan: PS50011
IPR000719
488-765 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

KGFKEKLGAGGFGAVYRGVLANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSEGRHRLLVYEFMKNGSLDDFLFVKEDASGKLLDWETRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDDNFNAKVCDFGLAKLINSKDHRYRTLTSVRGTRGYLAPEWLANLPITSKSDIYSYGMLLLEIVSGRRNFDVSAETSGKRFSIWAYEEFEKGNINCIVDKRLAEHEVDMEQAIRAIMVSFWCIQEQPSQRPTMGKVVQMLEGI

HMMSmart: SM00220
IPR002290
488-762 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

KGFKEKLGAGGFGAVYRGVLANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSEGRHRLLVYEFMKNGSLDDFLFVKEDASGKLLDWETRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDDNFNAKVCDFGLAKLINSKDHRYRTLTSVRGTRGYLAPEWLANLPITSKSDIYSYGMLLLEIVSGRRNFDVSAETSGKRFSIWAYEEFEKGNINCIVDKRLAEHEVDMEQAIRAIMVSFWCIQEQPSQRPTMGKVVQML

HMMSmart: SM00219
IPR020635
490-762 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FKEKLGAGGFGAVYRGVLANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSEGRHRLLVYEFMKNGSLDDFLFVKEDASGKLLDWETRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDDNFNAKVCDFGLAKLINSKDHRYRTLTSVRGTRGYLAPEWLANLPITSKSDIYSYGMLLLEIVSGRRNFDVSAETSGKRFSIWAYEEFEKGNINCIVDKRLAEHEVDMEQAIRAIMVSFWCIQEQPSQRPTMGKVVQML

HMMPfam: PF00069
IPR000719
491-760 Pkinase,Ser-thr
Protein kinase, catalytic domain

KEKLGAGGFGAVYRGVLANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFCSEGRHRLLVYEFMKNGSLDDFLFVKEDASGKLLDWETRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDDNFNAKVCDFGLAKLINSKDHRYRTLTSVRGTRGYLAPEWLANLPITSKSDIYSYGMLLLEIVSGRRNFDVSAETSGKRFSIWAYEEFEKGNINCIVDKRLAEHEVDMEQAIRAIMVSFWCIQEQPSQRPTMGKVVQ

PatternScan: PS00107
IPR017441
494-516 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGAGGFGAVYRGVLANRTVVAVK

Gene3D: G3DSA:1.10.510.10
565-765 no description

NGSLDDFLFVKEDASGKLLDWETRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDDNFNAKVCDFGLAKLINSKDHRYRTLTSVRGTRGYLAPEWLANLPITSKSDIYSYGMLLLEIVSGRRNFDVSAETSGKRFSIWAYEEFEKGNINCIVDKRLAEHEVDMEQAIRAIMVSFWCIQEQPSQRPTMGKVVQMLEGI

PatternScan: PS00108
IPR008271
610-622 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHCDIKPENILL

Seg: seg
781-824 seg

SLGGTSSGNVSSSISALSTFATSAPAPSSSSSSSLQLGAISSVS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox