PRGDB00206977 (Aquca_023_00040.1)

From PRG Wiki
Jump to: navigation, search
Aquca_023_00040.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia coerulea

Comment?

DNA Sequence

ATGCTGATAAATTTCTCTATCTCACTCTCAACCTTCTTCTTCCTTATTCACTTTCTCTTGTTTCCTATTTCTTATGCAAACATACCCTTAGGTTCAACTCTCACACCTGTTTCCACTTCTATCAACAACTCAATAAACTGGACTTCACCCAACAATACTTACTCTCTTAGTTTCATTCCCATTGCTTCTTCTTATTCTGCTGCTATTTCTTTCTCTGGTATTCCAGTATGGAAAGCTGGTGGAGATGCTGGTATTGTTGACTCTTCAGCTCGTTTTCAACTTCTTCTTAATGGTAATCTTCGCTTAACTAATGGTTCTGGGGGTGTAGTTTGGGAATCTAACACGCCAAATCGAGGAGTTACTACTGCACTACTTGATGATTCAGGTAATTTATCTCTAAGAAATGGGTCAATCACTGTTTGGTCTACTTTTGAGAATCCAACTGATACCATCTTGTCTAATCAAAATTTCACAACTTCAATGAGTTTGCAATCTGGTTCTTATTCATTTGTTTTGCAAAATTCTGGTTATCTTACTCTTAGATGGAACAATAGTATCATGTATTGGAATGAAGCTCTTAATTCTTCATTTATTGGCAATTTATCTTCTCCAAGTTTGCGTTTTCAACAAATTGGAATTATACAGCTTTCTGGTCCTACATTATCTGTTCCTGTTAATATGGCTTATAGTAGTGATTATGGTGAAGGGACTGATATTTTTAGATATTTAAGACTTGATTCTGATGGCAATTTAAGGATATATAGTTCTGATAGAGGTAGTGGTACTTCAACCGAAAGATGGGCAGCTGTTTTAGATCAATGTAGAGTTTATGGATGGTGTGGTAATATGGGTATTTGTAGTTATAACGATTCGGCGCCTGTATGTGGTTGTCCGTCTCAGAATTTCGAGTTTTTGGATCCAAATGATAGTAGAAAAGGTTGTAAGAGGAAGGTCGAGATTGCAGATTGCCCAAATAATGCTACTATGCTGCAATTGGAACATACAGAGTTTCTTATATATCCACCCGAGACTTCTTCTCAGCTTTACAGAATTGGGATTTCGGCTTGTAGGGAAAACTGTTTAGTGGGAGCTTCATGTGTTGCTTCTACCTCTTTAGCGGACGGAACTGGACAATGTTATCTGATAGGGACGGATTTTGTTAGTGGGAGCCAATCTCCGGCTCTTCCTAGTAGTTCTTTCATTAAGGTTTGCAGTCCAGAGCTCCCTAATCGCTCTTCATCTACTATGAACCCAAACCAGAGGAGTTCCAAGAAACTACCTGCTTGGGTTTTTGCTGTTGTGGTTGTGATTACTCTGGTGGCTTTGGTACTTCTGCAGTTTGGACTGTGGCTATGGTGTTGTAAGAACAGCCCCAGATATGGGGGGTTATCTGTGCAATATGCTCTTCTGGAGTATGCCTCAGGTGCTCCGGTTCAGTTCTCGTACAAGGAACTTCAGCGTTCAACCAAAGGATTTAAGGATAAGCTTGGAGCTGGAGGGTTTGGAGCTGTTTATAAAGGTATTCTGGCCAATAGAACTGTGGTTGCAGTCAAGCAACTTGAAGGAATTGAGCAGGGTGAAAAACAGTTTAGGATGGAGGTAGCAACAATAAGTAGCACACACCATCTAAATTTGGTGAGATTAATTGGGTTTTCCTCCGAAGGTCGACACAGACTTCTTGTTTACGAGTTCATGAAAAATGGGTCGTTGGATGATTTCCTATTTGTAAAGGAAGAGGCATCTGCAAAATTGTTGGACTGGAAGATTCGATTCAATGTAGCACTTGGAACAGCAAGGGGCATCACTTATCTTCATGAGGAATGTCGAGATTGCATCGTTCATTGTGACATAAAACCTGAGAATATACTTCTGGATGAAAACCTCAATGCCAAGGTGTCTGATTTTGGCTTGGCAAAGCTCATCAGTTCCAAAGACCAACGATACCGAACTTTAACAAGTGTAAGAGGGACAAGAGGGTACTTGGCACCTGAATGGCTTGCAAACCTTCCAATAACATCTAAATCTGATGTCTATAGTTATGGAATGGTGTTGTTGGAGATAGTAAGTGGGCGAAGGAACTTCGAAGTATCTGTGGAGACAAATTGGAAGAAGTTTTCGATGTGGGCATACGAAGAGTATGAGAGGGGACTTGTGAACAGCATTGTTGATAAAAGACTAGCTGAGCATGAAGTAGACATGGAGCAAGTGATGAGAGCTATAGAGGTGAGCTTTTGGTGCATCCAAGAGCAACAAACCCAGAGGCCTACAATGGGAAAAGTAGTACAAATGCTAGAAGGAATAAAAGCAATTGAGAAGCCTCCAGCCCCAAAAAGCAGAACAGAAGGTTCTGTGGGTGGCACAAGTATCTGGAATGCCAGCAGTGGTATTAGCGCACTCTCCACCTTTGCACCTTCAGCTCAAGCACCATCTTTTTCATCATCAACCATGCAAATGGGGGCTATATCTTCTGTTTCCTCGAAGGGTAGCTGA


Protein sequences

Name Description Sequence
Aquca_023_00040.1 protein obtained from Pythozome database for gene Aquca_023_00040.1

MLINFSISLSTFFFLIHFLLFPISYANIPLGSTLTPVSTSINNSINWTSPNNTYSLSFIPIASSYSAAISFSGIPVWKAGGDAGIVDSSARFQLLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSITVWSTFENPTDTILSNQNFTTSMSLQSGSYSFVLQNSGYLTLRWNNSIMYWNEALNSSFIGNLSSPSLRFQQIGIIQLSGPTLSVPVNMAYSSDYGEGTDIFRYLRLDSDGNLRIYSSDRGSGTSTERWAAVLDQCRVYGWCGNMGICSYNDSAPVCGCPSQNFEFLDPNDSRKGCKRKVEIADCPNNATMLQLEHTEFLIYPPETSSQLYRIGISACRENCLVGASCVASTSLADGTGQCYLIGTDFVSGSQSPALPSSSFIKVCSPELPNRSSSTMNPNQRSSKKLPAWVFAVVVVITLVALVLLQFGLWLWCCKNSPRYGGLSVQYALLEYASGAPVQFSYKELQRSTKGFKDKLGAGGFGAVYKGILANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFSSEGRHRLLVYEFMKNGSLDDFLFVKEEASAKLLDWKIRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDENLNAKVSDFGLAKLISSKDQRYRTLTSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLEIVSGRRNFEVSVETNWKKFSMWAYEEYERGLVNSIVDKRLAEHEVDMEQVMRAIEVSFWCIQEQQTQRPTMGKVVQMLEGIKAIEKPPAPKSRTEGSVGGTSIWNASSGISALSTFAPSAQAPSFSSSTMQMGAISSVSSKGS*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF814
1-810 SUBFAMILY NOT NAMED

MLINFSISLSTFFFLIHFLLFPISYANIPLGSTLTPVSTSINNSINWTSPNNTYSLSFIPIASSYSAAISFSGIPVWKAGGDAGIVDSSARFQLLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSITVWSTFENPTDTILSNQNFTTSMSLQSGSYSFVLQNSGYLTLRWNNSIMYWNEALNSSFIGNLSSPSLRFQQIGIIQLSGPTLSVPVNMAYSSDYGEGTDIFRYLRLDSDGNLRIYSSDRGSGTSTERWAAVLDQCRVYGWCGNMGICSYNDSAPVCGCPSQNFEFLDPNDSRKGCKRKVEIADCPNNATMLQLEHTEFLIYPPETSSQLYRIGISACRENCLVGASCVASTSLADGTGQCYLIGTDFVSGSQSPALPSSSFIKVCSPELPNRSSSTMNPNQRSSKKLPAWVFAVVVVITLVALVLLQFGLWLWCCKNSPRYGGLSVQYALLEYASGAPVQFSYKELQRSTKGFKDKLGAGGFGAVYKGILANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFSSEGRHRLLVYEFMKNGSLDDFLFVKEEASAKLLDWKIRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDENLNAKVSDFGLAKLISSKDQRYRTLTSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLEIVSGRRNFEVSVETNWKKFSMWAYEEYERGLVNSIVDKRLAEHEVDMEQVMRAIEVSFWCIQEQQTQRPTMGKVVQMLEGIKAIEKPPAPKSRTEGSVGGTSIWNASSGISALSTFAPSAQAPS

HMMPanther: PTHR24420
1-810 FAMILY NOT NAMED,FAMILY NOT NAMED

MLINFSISLSTFFFLIHFLLFPISYANIPLGSTLTPVSTSINNSINWTSPNNTYSLSFIPIASSYSAAISFSGIPVWKAGGDAGIVDSSARFQLLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSITVWSTFENPTDTILSNQNFTTSMSLQSGSYSFVLQNSGYLTLRWNNSIMYWNEALNSSFIGNLSSPSLRFQQIGIIQLSGPTLSVPVNMAYSSDYGEGTDIFRYLRLDSDGNLRIYSSDRGSGTSTERWAAVLDQCRVYGWCGNMGICSYNDSAPVCGCPSQNFEFLDPNDSRKGCKRKVEIADCPNNATMLQLEHTEFLIYPPETSSQLYRIGISACRENCLVGASCVASTSLADGTGQCYLIGTDFVSGSQSPALPSSSFIKVCSPELPNRSSSTMNPNQRSSKKLPAWVFAVVVVITLVALVLLQFGLWLWCCKNSPRYGGLSVQYALLEYASGAPVQFSYKELQRSTKGFKDKLGAGGFGAVYKGILANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFSSEGRHRLLVYEFMKNGSLDDFLFVKEEASAKLLDWKIRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDENLNAKVSDFGLAKLISSKDQRYRTLTSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLEIVSGRRNFEVSVETNWKKFSMWAYEEYERGLVNSIVDKRLAEHEVDMEQVMRAIEVSFWCIQEQQTQRPTMGKVVQMLEGIKAIEKPPAPKSRTEGSVGGTSIWNASSGISALSTFAPSAQAPS

Seg: seg
2-24 seg

LINFSISLSTFFFLIHFLLFPIS

ProfileScan: PS50927
IPR001480
32-146 BULB_LECTIN
Bulb-type lectin domain

STLTPVSTSINNSINWTSPNNTYSLSFIPIASSYSAAISFSGIPVWKAGGDAGIVDSSARFQLLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSITVWSTFEN

Seg: seg
38-53 seg

STSINNSINWTSPNNT

HMMSmart: SM00108
IPR001480
38-147 Bulb-type mannose-specific lectin
Bulb-type lectin domain

STSINNSINWTSPNNTYSLSFIPIASSYSAAISFSGIPVWKAGGDAGIVDSSARFQLLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSITVWSTFENP

Seg: seg
57-72 seg

SFIPIASSYSAAISFS

superfamily: SSF51110
IPR001480
69-197 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

ISFSGIPVWKAGGDAGIVDSSARFQLLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSITVWSTFENPTDTILSNQNFTTSMSLQSGSYSFVLQNSGYLTLRWNNSIMYWNEALNSSF

HMMPfam: PF01453
IPR001480
75-159 B_lectin
Bulb-type lectin domain

PVWKAGGDAGIVDSSARFQLLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSITVWSTFENPTDTILSNQNFTT

Gene3D: G3DSA:2.90.10.10
IPR001480
76-191 no description
Bulb-type lectin domain

VWKAGGDAGIVDSSARFQLLLNGNLRLTNGSGGVVWESNTPNRGVTTALLDDSGNLSLRNGSITVWSTFENPTDTILSNQNFTTSMSLQSGSYSFVLQNSGYLTLRWNNSIMYWNE

Seg: seg
94-108 seg

LLLNGNLRLTNGSGG

ProfileScan: PS50927
IPR001480
148-266 BULB_LECTIN
Bulb-type lectin domain

TDTILSNQNFTTSMSLQSGSYSFVLQNSGYLTLRWNNSIMYWNEALNSSFIGNLSSPSLRFQQIGIIQLSGPTLSVPVNMAYSSDYGEGTDIFRYLRLDSDGNLRIYSSDRGSGTSTER

HMMPfam: PF00954
IPR000858
236-298 S_locus_glycop
S-locus glycoprotein

GTDIFRYLRLDSDGNLRIYSSDRGSGTSTERWAAVLDQCRVYGWCGNMGICSYNDSAPVCGCP

Seg: seg
388-399 seg

SGSQSPALPSSS

Seg: seg
426-445 seg

LPAWVFAVVVVITLVALVLL

Gene3D: G3DSA:3.30.200.20
476-564 no description

APVQFSYKELQRSTKGFKDKLGAGGFGAVYKGILANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFSSEGRHRLLVYEF

superfamily: SSF56112
IPR011009
478-795 Protein kinase-like (PK-like)
Protein kinase-like domain

VQFSYKELQRSTKGFKDKLGAGGFGAVYKGILANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFSSEGRHRLLVYEFMKNGSLDDFLFVKEEASAKLLDWKIRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDENLNAKVSDFGLAKLISSKDQRYRTLTSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLEIVSGRRNFEVSVETNWKKFSMWAYEEYERGLVNSIVDKRLAEHEVDMEQVMRAIEVSFWCIQEQQTQRPTMGKVVQMLEGIKAIEKPPAPKSRTEGSVGGTSIWNASSG

HMMSmart: SM00220
IPR002290
490-764 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

KGFKDKLGAGGFGAVYKGILANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFSSEGRHRLLVYEFMKNGSLDDFLFVKEEASAKLLDWKIRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDENLNAKVSDFGLAKLISSKDQRYRTLTSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLEIVSGRRNFEVSVETNWKKFSMWAYEEYERGLVNSIVDKRLAEHEVDMEQVMRAIEVSFWCIQEQQTQRPTMGKVVQML

ProfileScan: PS50011
IPR000719
490-767 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

KGFKDKLGAGGFGAVYKGILANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFSSEGRHRLLVYEFMKNGSLDDFLFVKEEASAKLLDWKIRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDENLNAKVSDFGLAKLISSKDQRYRTLTSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLEIVSGRRNFEVSVETNWKKFSMWAYEEYERGLVNSIVDKRLAEHEVDMEQVMRAIEVSFWCIQEQQTQRPTMGKVVQMLEGI

HMMSmart: SM00219
IPR020635
492-764 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FKDKLGAGGFGAVYKGILANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFSSEGRHRLLVYEFMKNGSLDDFLFVKEEASAKLLDWKIRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDENLNAKVSDFGLAKLISSKDQRYRTLTSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLEIVSGRRNFEVSVETNWKKFSMWAYEEYERGLVNSIVDKRLAEHEVDMEQVMRAIEVSFWCIQEQQTQRPTMGKVVQML

HMMPfam: PF00069
IPR000719
493-762 Pkinase,Ser-thr
Protein kinase, catalytic domain

KDKLGAGGFGAVYKGILANRTVVAVKQLEGIEQGEKQFRMEVATISSTHHLNLVRLIGFSSEGRHRLLVYEFMKNGSLDDFLFVKEEASAKLLDWKIRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDENLNAKVSDFGLAKLISSKDQRYRTLTSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLEIVSGRRNFEVSVETNWKKFSMWAYEEYERGLVNSIVDKRLAEHEVDMEQVMRAIEVSFWCIQEQQTQRPTMGKVVQ

PatternScan: PS00107
IPR017441
496-518 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGAGGFGAVYKGILANRTVVAVK

Gene3D: G3DSA:1.10.510.10
565-779 no description

MKNGSLDDFLFVKEEASAKLLDWKIRFNVALGTARGITYLHEECRDCIVHCDIKPENILLDENLNAKVSDFGLAKLISSKDQRYRTLTSVRGTRGYLAPEWLANLPITSKSDVYSYGMVLLEIVSGRRNFEVSVETNWKKFSMWAYEEYERGLVNSIVDKRLAEHEVDMEQVMRAIEVSFWCIQEQQTQRPTMGKVVQMLEGIKAIEKPPAPKSR

PatternScan: PS00108
IPR008271
612-624 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHCDIKPENILL

Seg: seg
800-815 seg

STFAPSAQAPSFSSST






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox