PRGDB00206979 (Aquca_023_00020.1)

From PRG Wiki
Jump to: navigation, search
Aquca_023_00020.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia coerulea

Comment?

DNA Sequence

ATGGCAATGATGGATGAATATTATGTGGGGGAGATTGTTTCAAATGCCAGCTCAGAACCAATGGTGAGCGGAGGCAATGTCTTCACTTTAGCTGAAGTTTCTAAACACAATAACTCGAAGGATTGTTGGCTTGTGATTAACAACAAGGTTTATGACGTGACAAAATTTATGGACGACCATCCTGGTGGTGACCTGGCTTTGTTAAGTGCTACAGGGAAAGATGCGACTGATGATTTCAAGGATGTCGGTCACAGTAGCAGCGCAATGGCAATAATGGATGAATACTATGTGGGGGAGTTTGCTACAAATGTCAGCGTAGAATCAATTGTTGATGATTTAACAGGGTGGGATACGACTGATAGCACCACAATGGCAATGATGGATGGATATTCTGTTGGGGAGCCTGTTTCAAATTCCGGCTCAGAATCAATTGCTAGGTTATTTAGTGAACTAGCAAGAGAGAAACCACGACCATATTCACATGCGGAACTTATGAAATTTACAGAAGAATTTTCTATTAAAGTAGGTTCTGGTGGGTTTGGTGATGTGTACAAAGGTCAATTTCCTGATGGTGTGCCGGTAGCTGTTAAGGTACTGAAGAATAGTCACCCGGATGTGATGGAAAAGCAATTTGTGGCTGAAGTGAGCACAATGGGGAGAACGTACCATCGAAACTTAATTAAGCTATATGGTTTTTGTTATGAAGACAACATAAAAGCACTTATCTACGAATACATGGAGAATGGAGCTTTAGATAAGGTTCTGTTTAAGAACCACCTTGACTTACAATGGGGGAAGTTGTATAATATTGCAATAGAGATAGCACAGGGGATCTCTTATTTACACGACAGTTGCCATCCGCAAATAATTCACCATGACATAAAGCCTGGTAATGTGCTCCTTGACTCAAAACTTTCACCTAAGGTTATAGATTTTGGAATGGCTAGGCTAAATAGGGATTTGAGTCAATTCGCACAAACCGGAATTAGAGGAACTTACGGTTATGTTGCCCCAGAAATTTGTCTGGGAATGCAAGCAGTAAGTTATAAATGTGATGTTTACAGCTTTGGCATGATGTTGTTTGATATTTTGGGGAGCAAGAGGAAGGTTGCAGGCCAAGGGTGGTTACCAGGAGAAGTTCGGGACAAATTTCAGCAAAAACAACTAGAGACAATTATTATGGACTGTGGCATTGTGGAGGAGGAGGATAAAATAGATGCAAAGACATTATCTATAGTTGCATTATTGTGTGCTGAGCACAACCCTCGAAATAGACCTTCCATGAGCACTGTGGTGAAGATGCTTGAGGGTGAAATACCACTTTGGACTCCTGTCGATCCATTTCCGTTGTATGATTCTTCAAGTGAAAATAGCACAATAGGTGGCTCCACAAGATCTAGGCATCGTGGCCATTCCTAA


Protein sequences

Name Description Sequence
Aquca_023_00020.1 protein obtained from Pythozome database for gene Aquca_023_00020.1

MAMMDEYYVGEIVSNASSEPMVSGGNVFTLAEVSKHNNSKDCWLVINNKVYDVTKFMDDHPGGDLALLSATGKDATDDFKDVGHSSSAMAIMDEYYVGEFATNVSVESIVDDLTGWDTTDSTTMAMMDGYSVGEPVSNSGSESIARLFSELAREKPRPYSHAELMKFTEEFSIKVGSGGFGDVYKGQFPDGVPVAVKVLKNSHPDVMEKQFVAEVSTMGRTYHRNLIKLYGFCYEDNIKALIYEYMENGALDKVLFKNHLDLQWGKLYNIAIEIAQGISYLHDSCHPQIIHHDIKPGNVLLDSKLSPKVIDFGMARLNRDLSQFAQTGIRGTYGYVAPEICLGMQAVSYKCDVYSFGMMLFDILGSKRKVAGQGWLPGEVRDKFQQKQLETIIMDCGIVEEEDKIDAKTLSIVALLCAEHNPRNRPSMSTVVKMLEGEIPLWTPVDPFPLYDSSSENSTIGGSTRSRHRGHS*

Domains

Domain Start-End Description Sequence

superfamily: SSF55856
IPR001199
24-100 Cytochrome b5-like heme/steroid binding domain
Cytochrome b5

GGNVFTLAEVSKHNNSKDCWLVINNKVYDVTKFMDDHPGGDLALLSATGKDATDDFKDVGHSSSAMAIMDEYYVGEF

ProfileScan: PS50255
IPR001199
25-101 CYTOCHROME_B5_2
Cytochrome b5

GNVFTLAEVSKHNNSKDCWLVINNKVYDVTKFMDDHPGGDLALLSATGKDATDDFKDVGHSSSAMAIMDEYYVGEFA

Gene3D: G3DSA:3.10.120.10
IPR001199
26-103 no description
Cytochrome b5

NVFTLAEVSKHNNSKDCWLVINNKVYDVTKFMDDHPGGDLALLSATGKDATDDFKDVGHSSSAMAIMDEYYVGEFATN

HMMPfam: PF00173
IPR001199
27-99 Cyt-b5
Cytochrome b5

VFTLAEVSKHNNSKDCWLVINNKVYDVTKFMDDHPGGDLALLSATGKDATDDFKDVGHSSSAMAIMDEYYVGE

FPrintScan: PR00363
IPR001199
50-60 CYTOCHROMEB5
Cytochrome b5

VYDVTKFMDDH

PatternScan: PS00191
IPR018506
56-63 CYTOCHROME_B5_1
Cytochrome b5, heme-binding site

FMDDHPGG

FPrintScan: PR00363
IPR001199
60-74 CYTOCHROMEB5
Cytochrome b5

HPGGDLALLSATGKD

FPrintScan: PR00363
IPR001199
75-82 CYTOCHROMEB5
Cytochrome b5

ATDDFKDV

FPrintScan: PR00363
IPR001199
88-100 CYTOCHROMEB5
Cytochrome b5

AMAIMDEYYVGEF

HMMPanther: PTHR24420
99-459 FAMILY NOT NAMED,FAMILY NOT NAMED

EFATNVSVESIVDDLTGWDTTDSTTMAMMDGYSVGEPVSNSGSESIARLFSELAREKPRPYSHAELMKFTEEFSIKVGSGGFGDVYKGQFPDGVPVAVKVLKNSHPDVMEKQFVAEVSTMGRTYHRNLIKLYGFCYEDNIKALIYEYMENGALDKVLFKNHLDLQWGKLYNIAIEIAQGISYLHDSCHPQIIHHDIKPGNVLLDSKLSPKVIDFGMARLNRDLSQFAQTGIRGTYGYVAPEICLGMQAVSYKCDVYSFGMMLFDILGSKRKVAGQGWLPGEVRDKFQQKQLETIIMDCGIVEEEDKIDAKTLSIVALLCAEHNPRNRPSMSTVVKMLEGEIPLWTPVDPFPLYDSSSENST

Seg: seg
117-128 seg

DTTDSTTMAMMD

superfamily: SSF56112
IPR011009
141-443 Protein kinase-like (PK-like)
Protein kinase-like domain

SESIARLFSELAREKPRPYSHAELMKFTEEFSIKVGSGGFGDVYKGQFPDGVPVAVKVLKNSHPDVMEKQFVAEVSTMGRTYHRNLIKLYGFCYEDNIKALIYEYMENGALDKVLFKNHLDLQWGKLYNIAIEIAQGISYLHDSCHPQIIHHDIKPGNVLLDSKLSPKVIDFGMARLNRDLSQFAQTGIRGTYGYVAPEICLGMQAVSYKCDVYSFGMMLFDILGSKRKVAGQGWLPGEVRDKFQQKQLETIIMDCGIVEEEDKIDAKTLSIVALLCAEHNPRNRPSMSTVVKMLEGEIPLWT

Gene3D: G3DSA:3.30.200.20
153-232 no description

REKPRPYSHAELMKFTEEFSIKVGSGGFGDVYKGQFPDGVPVAVKVLKNSHPDVMEKQFVAEVSTMGRTYHRNLIKLYGF

HMMSmart: SM00220
IPR002290
169-435 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

EEFSIKVGSGGFGDVYKGQFPDGVPVAVKVLKNSHPDVMEKQFVAEVSTMGRTYHRNLIKLYGFCYEDNIKALIYEYMENGALDKVLFKNHLDLQWGKLYNIAIEIAQGISYLHDSCHPQIIHHDIKPGNVLLDSKLSPKVIDFGMARLNRDLSQFAQTGIRGTYGYVAPEICLGMQAVSYKCDVYSFGMMLFDILGSKRKVAGQGWLPGEVRDKFQQKQLETIIMDCGIVEEEDKIDAKTLSIVALLCAEHNPRNRPSMSTVVKML

HMMSmart: SM00219
IPR020635
169-435 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

EEFSIKVGSGGFGDVYKGQFPDGVPVAVKVLKNSHPDVMEKQFVAEVSTMGRTYHRNLIKLYGFCYEDNIKALIYEYMENGALDKVLFKNHLDLQWGKLYNIAIEIAQGISYLHDSCHPQIIHHDIKPGNVLLDSKLSPKVIDFGMARLNRDLSQFAQTGIRGTYGYVAPEICLGMQAVSYKCDVYSFGMMLFDILGSKRKVAGQGWLPGEVRDKFQQKQLETIIMDCGIVEEEDKIDAKTLSIVALLCAEHNPRNRPSMSTVVKML

ProfileScan: PS50011
IPR000719
169-449 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

EEFSIKVGSGGFGDVYKGQFPDGVPVAVKVLKNSHPDVMEKQFVAEVSTMGRTYHRNLIKLYGFCYEDNIKALIYEYMENGALDKVLFKNHLDLQWGKLYNIAIEIAQGISYLHDSCHPQIIHHDIKPGNVLLDSKLSPKVIDFGMARLNRDLSQFAQTGIRGTYGYVAPEICLGMQAVSYKCDVYSFGMMLFDILGSKRKVAGQGWLPGEVRDKFQQKQLETIIMDCGIVEEEDKIDAKTLSIVALLCAEHNPRNRPSMSTVVKMLEGEIPLWTPVDPFP

HMMPfam: PF00069
IPR000719
174-433 Pkinase,Ser-thr
Protein kinase, catalytic domain

KVGSGGFGDVYKGQFPDGVPVAVKVLKNSHPDVMEKQFVAEVSTMGRTYHRNLIKLYGFCYEDNIKALIYEYMENGALDKVLFKNHLDLQWGKLYNIAIEIAQGISYLHDSCHPQIIHHDIKPGNVLLDSKLSPKVIDFGMARLNRDLSQFAQTGIRGTYGYVAPEICLGMQAVSYKCDVYSFGMMLFDILGSKRKVAGQGWLPGEVRDKFQQKQLETIIMDCGIVEEEDKIDAKTLSIVALLCAEHNPRNRPSMSTVVK

PatternScan: PS00107
IPR017441
175-197 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGSGGFGDVYKGQFPDGVPVAVK

Gene3D: G3DSA:1.10.510.10
233-435 no description

CYEDNIKALIYEYMENGALDKVLFKNHLDLQWGKLYNIAIEIAQGISYLHDSCHPQIIHHDIKPGNVLLDSKLSPKVIDFGMARLNRDLSQFAQTGIRGTYGYVAPEICLGMQAVSYKCDVYSFGMMLFDILGSKRKVAGQGWLPGEVRDKFQQKQLETIIMDCGIVEEEDKIDAKTLSIVALLCAEHNPRNRPSMSTVVKML

PatternScan: PS00108
IPR008271
289-301 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHHDIKPGNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox