PRGDB00206981 (Aquca_023_00191.2)

From PRG Wiki
Jump to: navigation, search
Aquca_023_00191.2
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia coerulea

Comment?

DNA Sequence

ATGTATTCCATGAGAACCTCATTTTCTGTTATTCTTTTCGTCATCTCTCTCTTTTTCCACAGATCAGGTTTTTGCTTTGCACTAGAAAGCATTTCATCAAACAAACTCATAAGAGATTCGGATTCTATTACTTCATTGAATAAAACATTCAGATTAGGCTTTTTTAGTCCTGCTGATTCGAGTAATCGTTACGTTGGTATTTGGTATAACTCACTGCCAAGAGGGAAAAGAGTTGTTTGGGTTGCCAACAGAGATAATCCCTTGACTGATTCCTTAGGAATCTTGAGGATTATTGATGATGGTAATTTAGTTGTTTTAGATGGAAAACAAAATATTGTATGGTCAACAAATGTATCAGCTAATGCAAATAGTTCGAGAGCGGAGCTGTTGGAATCTGGAAATCTTGTATTAACAGGAACTAGTGCTAATACCTTGTGGCAGAGTTTTGATCACCCAACAGATACATTCTTACCAAACATGAGGTTTGGTGTTAATATAAATACAGGGATGAAACAAGAGCTAATACCATGGAAAAATGATTCTGATCCTTCCCAAGGAAGGTTCCGTTTGGAGCTTGAGCCTCTAAACATTGCTCAATTAGTTATATGGGAAGGATCTCTATGCCACTGGCGAAGTGGTCCCTGGGATGGTACAGTCTTCATTGGAGTGGAAGGAATGTATGCGGATGCTTCCAACGGCTTTGGTCTTGATCGAAATGAGGAAGGAGTATATCTGACTGTTTCTTATAGCAATAAGACTTTACATCCGAGGTATGCTCTGAATTCTCTAGGACAAATAAGCGAGAACTTTTATAACGAAACAGAAAACCGATGGGATCAATCCTGGTTCATGCCAAAGACTGAGTGTGATTTCTATGGTAAGTGTGGGTGTTTTGGGTTCTGTAACATTTTAAGTAAACCAATATGTAGTTGTTTGAAAGGGTATGAGCCTAGTTCAAGTGAAGAGTGGAATAAGGGAAATTGGTCTGGTGGATGTGTTAAGCGAAAGCCATTACAGTGTGAGCAAAATAATAGCAGCGGTGATGAGGTAAAAGAAGATGGATTTTTTAAGTATGAAAGGATGAAAGTTCCTGATCATATGGTAAATTTGGTGCGTGGTAAAGACTTTTTTGGTACAGACTTGGAAGACTGTAAACAAAGATGTTTAAGGAATTGTTCTTGCAGCGCTTATTCTTATGGACCTAAAGGTTGTATGTGGTGGGATGGAAATTTAATCGATGTGCAGAGGTTTTCAATGGATGGTGCGGATCTTTACATCCGTGTTGCACATTCGGAGCTTGACGAGAAGAAAAATATGGTGCATGCTTATATAATTATAGTCGTCATTGGGCTATCTGTTATCGCTTTCAGCATGTATATCCTTCGGAGGTGGGCAATGAAAAAGAAGAGGATGGCACAGAGGAGAGTTTTAGTGCTCGGCAAGAATGACTCTACCAAAGAACTCTTAGATACAGACAAACTTGATTCCGAACCATCAATTTTCAAATATGAGAAACTAGCAGTTTCCACAAATAACTTTGATCCAGCCAATAAGCTTGGGGAAGGTGGTTTTGGTTCGGTGTACATGGGCAAGTTGCCAAGTGGGAAAGAAATAGCTGTTAAAAGACTTTCCAAGAGTTCTGGACAAGGCACACAAGAATTCAAGAATGAAGTACTCATAATTTCAAAACTCCAACATAGAAATCTGGTTAGGCTTCTTGGCTGCTGCATTGAAGGTGAAGAAAAGATGTTGATCTACGAATACATGCCCAACAAAAGCTTAGATGCTTTTCTCTTTGGGGTACTACATACAACATACATGTGGCACCATCTTTACCGTACATCATGGTGCCACATGTCATCATCTAATGGACTCTCTCTTGATGGCACAAGTTACAAAGTTAAAGCCAATTACTACAAAGATATTCTCTCATCATTACCTCATTAA


Protein sequences

Name Description Sequence
Aquca_023_00191.2 protein obtained from Pythozome database for gene Aquca_023_00191.2

MYSMRTSFSVILFVISLFFHRSGFCFALESISSNKLIRDSDSITSLNKTFRLGFFSPADSSNRYVGIWYNSLPRGKRVVWVANRDNPLTDSLGILRIIDDGNLVVLDGKQNIVWSTNVSANANSSRAELLESGNLVLTGTSANTLWQSFDHPTDTFLPNMRFGVNINTGMKQELIPWKNDSDPSQGRFRLELEPLNIAQLVIWEGSLCHWRSGPWDGTVFIGVEGMYADASNGFGLDRNEEGVYLTVSYSNKTLHPRYALNSLGQISENFYNETENRWDQSWFMPKTECDFYGKCGCFGFCNILSKPICSCLKGYEPSSSEEWNKGNWSGGCVKRKPLQCEQNNSSGDEVKEDGFFKYERMKVPDHMVNLVRGKDFFGTDLEDCKQRCLRNCSCSAYSYGPKGCMWWDGNLIDVQRFSMDGADLYIRVAHSELDEKKNMVHAYIIIVVIGLSVIAFSMYILRRWAMKKKRMAQRRVLVLGKNDSTKELLDTDKLDSEPSIFKYEKLAVSTNNFDPANKLGEGGFGSVYMGKLPSGKEIAVKRLSKSSGQGTQEFKNEVLIISKLQHRNLVRLLGCCIEGEEKMLIYEYMPNKSLDAFLFGVLHTTYMWHHLYRTSWCHMSSSNGLSLDGTSYKVKANYYKDILSSLPH*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-599 FAMILY NOT NAMED,FAMILY NOT NAMED

MYSMRTSFSVILFVISLFFHRSGFCFALESISSNKLIRDSDSITSLNKTFRLGFFSPADSSNRYVGIWYNSLPRGKRVVWVANRDNPLTDSLGILRIIDDGNLVVLDGKQNIVWSTNVSANANSSRAELLESGNLVLTGTSANTLWQSFDHPTDTFLPNMRFGVNINTGMKQELIPWKNDSDPSQGRFRLELEPLNIAQLVIWEGSLCHWRSGPWDGTVFIGVEGMYADASNGFGLDRNEEGVYLTVSYSNKTLHPRYALNSLGQISENFYNETENRWDQSWFMPKTECDFYGKCGCFGFCNILSKPICSCLKGYEPSSSEEWNKGNWSGGCVKRKPLQCEQNNSSGDEVKEDGFFKYERMKVPDHMVNLVRGKDFFGTDLEDCKQRCLRNCSCSAYSYGPKGCMWWDGNLIDVQRFSMDGADLYIRVAHSELDEKKNMVHAYIIIVVIGLSVIAFSMYILRRWAMKKKRMAQRRVLVLGKNDSTKELLDTDKLDSEPSIFKYEKLAVSTNNFDPANKLGEGGFGSVYMGKLPSGKEIAVKRLSKSSGQGTQEFKNEVLIISKLQHRNLVRLLGCCIEGEEKMLIYEYMPNKSLDAFLF

HMMPanther: PTHR24420:SF703
1-599 SUBFAMILY NOT NAMED

MYSMRTSFSVILFVISLFFHRSGFCFALESISSNKLIRDSDSITSLNKTFRLGFFSPADSSNRYVGIWYNSLPRGKRVVWVANRDNPLTDSLGILRIIDDGNLVVLDGKQNIVWSTNVSANANSSRAELLESGNLVLTGTSANTLWQSFDHPTDTFLPNMRFGVNINTGMKQELIPWKNDSDPSQGRFRLELEPLNIAQLVIWEGSLCHWRSGPWDGTVFIGVEGMYADASNGFGLDRNEEGVYLTVSYSNKTLHPRYALNSLGQISENFYNETENRWDQSWFMPKTECDFYGKCGCFGFCNILSKPICSCLKGYEPSSSEEWNKGNWSGGCVKRKPLQCEQNNSSGDEVKEDGFFKYERMKVPDHMVNLVRGKDFFGTDLEDCKQRCLRNCSCSAYSYGPKGCMWWDGNLIDVQRFSMDGADLYIRVAHSELDEKKNMVHAYIIIVVIGLSVIAFSMYILRRWAMKKKRMAQRRVLVLGKNDSTKELLDTDKLDSEPSIFKYEKLAVSTNNFDPANKLGEGGFGSVYMGKLPSGKEIAVKRLSKSSGQGTQEFKNEVLIISKLQHRNLVRLLGCCIEGEEKMLIYEYMPNKSLDAFLF

ProfileScan: PS50927
IPR001480
28-150 BULB_LECTIN
Bulb-type lectin domain

LESISSNKLIRDSDSITSLNKTFRLGFFSPADSSNRYVGIWYNSLPRGKRVVWVANRDNPLTDSLGILRIIDDGNLVVLDGKQNIVWSTNVSANANSSRAELLESGNLVLTGTSANTLWQSFD

HMMSmart: SM00108
IPR001480
34-152 Bulb-type mannose-specific lectin
Bulb-type lectin domain

NKLIRDSDSITSLNKTFRLGFFSPADSSNRYVGIWYNSLPRGKRVVWVANRDNPLTDSLGILRIIDDGNLVVLDGKQNIVWSTNVSANANSSRAELLESGNLVLTGTSANTLWQSFDHP

superfamily: SSF51110
IPR001480
65-183 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

VGIWYNSLPRGKRVVWVANRDNPLTDSLGILRIIDDGNLVVLDGKQNIVWSTNVSANANSSRAELLESGNLVLTGTSANTLWQSFDHPTDTFLPNMRFGVNINTGMKQELIPWKNDSDP

HMMPfam: PF01453
IPR001480
76-184 B_lectin
Bulb-type lectin domain

KRVVWVANRDNPLTDSLGILRIIDDGNLVVLDGKQNIVWSTNVSANANSSRAELLESGNLVLTGTSANTLWQSFDHPTDTFLPNMRFGVNINTGMKQELIPWKNDSDPS

Gene3D: G3DSA:2.90.10.10
IPR001480
185-221 no description
Bulb-type lectin domain

QGRFRLELEPLNIAQLVIWEGSLCHWRSGPWDGTVFI

HMMPfam: PF00954
IPR000858
210-318 S_locus_glycop
S-locus glycoprotein

WRSGPWDGTVFIGVEGMYADASNGFGLDRNEEGVYLTVSYSNKTLHPRYALNSLGQISENFYNETENRWDQSWFMPKTECDFYGKCGCFGFCNILSKPICSCLKGYEPS

ProfileScan: PS50948
IPR003609
340-429 PAN
Apple-like

CEQNNSSGDEVKEDGFFKYERMKVPDHMVNLVRGKDFFGTDLEDCKQRCLRNCSCSAYSYGPKGCMWWDGNLIDVQRFSMDGADLYIRVA

superfamily: SSF57414
348-432 Hairpin loop containing domain-like

DEVKEDGFFKYERMKVPDHMVNLVRGKDFFGTDLEDCKQRCLRNCSCSAYSYGPKGCMWWDGNLIDVQRFSMDGADLYIRVAHSE

HMMSmart: SM00473
IPR003609
350-428 divergent subfamily of APPLE domains
Apple-like

VKEDGFFKYERMKVPDHMVNLVRGKDFFGTDLEDCKQRCLRNCSCSAYSYGPKGCMWWDGNLIDVQRFSMDGADLYIRV

HMMPfam: PF08276
IPR013227
351-414 PAN_2
PAN-2 domain

KEDGFFKYERMKVPDHMVNLVRGKDFFGTDLEDCKQRCLRNCSCSAYSYGPKGCMWWDGNLIDV

Gene3D: G3DSA:3.30.200.20
493-589 no description

KLDSEPSIFKYEKLAVSTNNFDPANKLGEGGFGSVYMGKLPSGKEIAVKRLSKSSGQGTQEFKNEVLIISKLQHRNLVRLLGCCIEGEEKMLIYEYM

superfamily: SSF56112
IPR011009
498-619 Protein kinase-like (PK-like)
Protein kinase-like domain

PSIFKYEKLAVSTNNFDPANKLGEGGFGSVYMGKLPSGKEIAVKRLSKSSGQGTQEFKNEVLIISKLQHRNLVRLLGCCIEGEEKMLIYEYMPNKSLDAFLFGVLHTTYMWHHLYRTSWCHM

ProfileScan: PS50011
IPR000719
513-648 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDPANKLGEGGFGSVYMGKLPSGKEIAVKRLSKSSGQGTQEFKNEVLIISKLQHRNLVRLLGCCIEGEEKMLIYEYMPNKSLDAFLFGVLHTTYMWHHLYRTSWCHMSSSNGLSLDGTSYKVKANYYKDILSSLPH

HMMSmart: SM00219
IPR020635
513-648 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDPANKLGEGGFGSVYMGKLPSGKEIAVKRLSKSSGQGTQEFKNEVLIISKLQHRNLVRLLGCCIEGEEKMLIYEYMPNKSLDAFLFGVLHTTYMWHHLYRTSWCHMSSSNGLSLDGTSYKVKANYYKDILSSLPH

HMMPfam: PF07714
IPR001245
517-599 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

NKLGEGGFGSVYMGKLPSGKEIAVKRLSKSSGQGTQEFKNEVLIISKLQHRNLVRLLGCCIEGEEKMLIYEYMPNKSLDAFLF

PatternScan: PS00107
IPR017441
519-541 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGSVYMGKLPSGKEIAVK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox