PRGDB00206982 (Aquca_023_00192.1)

From PRG Wiki
Jump to: navigation, search
Aquca_023_00192.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Aquilegia coerulea

Comment?

DNA Sequence

ATGGCGGAAGGAGTTGCTTTTGGCATTGCTGAGAAAATTATAACAGATTTGGGTTCTCTTGCTCTTGAAGAAATTGGATTCACAGTGGGTTTTAAAAAAGAACTAAAGAAGCTTGAAAACACTGCAATTACTATCAAAGCTGTACTTTCACATGCTGAAGAGTTACAGTTAAACAATCTTCAAGTGAGAACATGGCTTACAAGGGTTAAAGATGCATCTTATGAAGCAGATGACATTATTACTGACTTTGCCACTCATGCTTTGAAAAAGAAACTTGTAAGCAATTTTTTCTCGCTTTCAAATTCAATTTTATTTCGTTATAAAATGGCTCAAAGAATTAAAGAAGTTAGAGGAAATTTCAATGATATTATAGCTGATAAGTCATTTCACTTATTAGATAATAGAGTTGAGAATTATACAAGAGTGTATGATGATAATGTTGAGAGGGAACATACCCATTCTTATGTCGTTGAATCAAAAATCTTTGGAAGAGATGTTGATAAAGAAAATGTTGTAGAATTATTGTTAGACCTGAATCCGCAAGATAACCCATCTGTTATTCCCATTCAAGGTATGGGTGGTCTTGGAAAAACTACACTTGCTCAATTGCTCTACAATGATAGTAGAATTAAGGTGGCGTTTAAGCAAAAAATGTGGGTTTGCGTCTCTCAGGATTTTGGTGTTAAGAGAATAACGGAAAAGATTATAAAATCGATTACCAAGAAAGAATGCCCTAATTTGGAGATGGACCAGCTACAGGCTTGTCTTCGAGAGCAACTTGAAGGGAAGAGATATTTACTAGTTTTAGATGATGTATGGAACGAAAATGCCGAGAAGTGGGAGAAGTTAAAAGATTTGTTAATCGGAGGTGCAAGGGGAAGCAAAATAATGGTAACTACAAGAAGTGAGAAGGTTGCATCAATCATGAGAACAGTGTCTACGTATCATTTGTCAGGATTGACGGATGATGACTGTTGGAAATTGTTTAAACATAGAGCGTTTGAGACAGGACAAGAACAAGAGCATCAGAAACTTGCAGAAATCGGGAAAGATATTGTGAGAAAGTGTGGGGGAGTGCCTCTGGCAGCAAAGGCCCTAGGAAGCTTAATGCACTCTAAAACTGAGGAACATGAATGGGTGCGTGTCAAAGAGAATGATGTCTGGGGACTGTCTCAAGAAATCACTGGGATTTTACCCGCACTTATGTTAAGTTATAATCATTTGCCATTCTATTTGAGACAGTGCTTTGCATATTGCTCGATTTATCCAAAGGGTTATAGAATTGGGAAGGAAGATTTGATCCTATCATGGATTGCACAAGGGTTTGTTCACTCATCTGGAAGAAGCCAGTTCTTGGAAGATATTGGTTGTGAGTATGTCAAAGAATTGATGTGGGGATCGTTTTTCCAAGAACCACAAGTAGACTGCTTTGGAAATCTTGTAAGCTTTACAGTTCATGATCTTGTCCATAACGTTGCACAATTTGTGGCTGGAACAGAGTGTTTCATTGTGGAAGGCGAAACAAAAAATGACATTCCTGAAGGAGTTCGACATTTAAGCATCACTGAAGATAATTTGTCAATTGGACTTCTAAGTTCCTTCTCTGAAAAATCAAATTTACGGTCACTTTACTTGAACACAAAAGTTTTTATTGGTGGAATTCTTCCAAGATTTAGATGCTTACGTGCATTGAGTTTGCAGTTAGAGTCTTGCAATGTTCCAACTTCCATTGGTAAGTTGAAGCACCTAAGGTACCTTGAGATTTGTTCTGAAAGTATTGTGGTAATCCCCAATTCTTTTTGCAAGCTCCAAAGTTTAGAAACCTTGAGACTCTACTGTTCTAAACTAAGAGAATTGCCTCGGGATATCAGGAAAATGACTAAACTCAGACATATTGATCTCGATGAGAGCTCTTCTTTGACGCACATGCCATCTGGCCTTGGTCACTTAACTTCTCTTCGTACACTGCCATTATTTGTTCCAGGGAAGAAGATTGGTTGCAAGTTGAATGAGTTGCATGCGCTAATACATATAGCAGGACGGTTGACTATTCAAAACCTTGAAAATGTGAATAATTTTAGAGACAGTGCTAAAGCAAACTTAAAGGGGAAAGAAAATCTTCAAATCTTGAAATTATTCTGGAACGAAATGGGCGATCAAGAAGTTGACAGAGAAGAAATTGCTTTTCATGTACTTGGGAATCTGGAGCCCTCCCAAAATATTAAAAGGTTAAAAATAAATGGTTATGGAAATCAAAGATTACCACGTTGGATGATGCAGCCACTGCTCCCGAATCTCATGAAGGTTACCCTTTCAGGATGTAGAAAATGCCAACATCTCCCTCCATTTGGTCAACTCCCATCTCTAAAGGTTCTTAAGTTGGAGAAAATGGATGCTCTTCAGTTCATTGAAGGTAGCCTGGTGGGAAGATCAAGGGAATGCTTCTCCTCACTGGAAAGGGTGTTTCTTCGCTCAATTCCTAATTTGGAGAATTGGATACAAATAAAAGAAGAAGAAAAATCATTACTGTCACTACCACGCCTTGCTCAACTGGTAGTGTGGGACTGCCCAAAGTTGACATCAATGCCACTACTTCCATCTCTGGAAGAACTGAATGTAGGCAAATGTAGAGAGAGGCTGATACACTCATTGTTAAAAGTGATTACATGGGATAGCACAATTTCGTTGTGTAGTTATTCCCTTGCAAATTTAAAGCATTTGAAAATTGGAGAATGTGATGATCTAGTGTGTTGGCCAGAAGTAGGGTTACAAGGCTTGACTTCTCTTGAATCTTTGATGATTGCGTTCTGCCCTCGCATGACAAATTTACCAGAAGAAGGGTTGCGAGGGATGACATCTCTACAGCGTCTGACAATTTTGGATTGTGAGAGCTTGAATTCTCTATCTGGTATGCGATACCTCACGGCACTTCAAGATCTGTCTCTTGTTCGGTGTAAAGAGGTTCATATTTTGGATGACATGGATGACCTTGCTTCCCTTGATACGCTGCACATTGAAACAATTCCAAAGCTTGTGTCTCTTCCCGAGGGGCTACGAAATGCGACCTCAATGCAAACTATTGCAGTTGTTGACTGTGAGGATTTGATGGTTTTGCCGGACTGTCTGGGAAATTTCACGTCACTTCAACAACTTCAAGTTTCAAGGTGTCCTAAGTTGGAAGCTTTTCCTAACGAAATGTCATATCCTACCACACTGCAACATCTTGTAATTTCTTGTTGTGAGGGTTTGAAAATTTGGCCGAATGGGTTAGGAAACCTCAAATCACTTCAGGGTCTTGGCATCTCTTGTTCCTCGAGCCTGCCCTCTCTTCCGGAAGAAATGCAGCATCTTTCTACCTTGAGAACACTTTCCTTAGGTGGCTGTAAGGGTTTCACGACTTTGCCAGATTGGCTTATAAATTTCACTTCTCTTCAACAGCTGGAAATTTATGATTTCCCAGACTTGAAGTGCTTGCCGGAATGGATGCAGAGTTTTCCTGCATTACAAGAGTTGTATATATTTCAATGTGGTCACTTGACTTCTCGATGCCGCAAAGAAAAAGGAGAAGACTGGCCTAAGATAGCTGGCGTGCCGAAAATTGAACTCGATCAAAATAGGATACAATAA


Protein sequences

Name Description Sequence
Aquca_023_00192.1 protein obtained from Pythozome database for gene Aquca_023_00192.1

MAEGVAFGIAEKIITDLGSLALEEIGFTVGFKKELKKLENTAITIKAVLSHAEELQLNNLQVRTWLTRVKDASYEADDIITDFATHALKKKLVSNFFSLSNSILFRYKMAQRIKEVRGNFNDIIADKSFHLLDNRVENYTRVYDDNVEREHTHSYVVESKIFGRDVDKENVVELLLDLNPQDNPSVIPIQGMGGLGKTTLAQLLYNDSRIKVAFKQKMWVCVSQDFGVKRITEKIIKSITKKECPNLEMDQLQACLREQLEGKRYLLVLDDVWNENAEKWEKLKDLLIGGARGSKIMVTTRSEKVASIMRTVSTYHLSGLTDDDCWKLFKHRAFETGQEQEHQKLAEIGKDIVRKCGGVPLAAKALGSLMHSKTEEHEWVRVKENDVWGLSQEITGILPALMLSYNHLPFYLRQCFAYCSIYPKGYRIGKEDLILSWIAQGFVHSSGRSQFLEDIGCEYVKELMWGSFFQEPQVDCFGNLVSFTVHDLVHNVAQFVAGTECFIVEGETKNDIPEGVRHLSITEDNLSIGLLSSFSEKSNLRSLYLNTKVFIGGILPRFRCLRALSLQLESCNVPTSIGKLKHLRYLEICSESIVVIPNSFCKLQSLETLRLYCSKLRELPRDIRKMTKLRHIDLDESSSLTHMPSGLGHLTSLRTLPLFVPGKKIGCKLNELHALIHIAGRLTIQNLENVNNFRDSAKANLKGKENLQILKLFWNEMGDQEVDREEIAFHVLGNLEPSQNIKRLKINGYGNQRLPRWMMQPLLPNLMKVTLSGCRKCQHLPPFGQLPSLKVLKLEKMDALQFIEGSLVGRSRECFSSLERVFLRSIPNLENWIQIKEEEKSLLSLPRLAQLVVWDCPKLTSMPLLPSLEELNVGKCRERLIHSLLKVITWDSTISLCSYSLANLKHLKIGECDDLVCWPEVGLQGLTSLESLMIAFCPRMTNLPEEGLRGMTSLQRLTILDCESLNSLSGMRYLTALQDLSLVRCKEVHILDDMDDLASLDTLHIETIPKLVSLPEGLRNATSMQTIAVVDCEDLMVLPDCLGNFTSLQQLQVSRCPKLEAFPNEMSYPTTLQHLVISCCEGLKIWPNGLGNLKSLQGLGISCSSSLPSLPEEMQHLSTLRTLSLGGCKGFTTLPDWLINFTSLQQLEIYDFPDLKCLPEWMQSFPALQELYIFQCGHLTSRCRKEKGEDWPKIAGVPKIELDQNRIQ*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
29-1191 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VGFKKELKKLENTAITIKAVLSHAEELQLNNLQVRTWLTRVKDASYEADDIITDFATHALKKKLVSNFFSLSNSILFRYKMAQRIKEVRGNFNDIIADKSFHLLDNRVENYTRVYDDNVEREHTHSYVVESKIFGRDVDKENVVELLLDLNPQDNPSVIPIQGMGGLGKTTLAQLLYNDSRIKVAFKQKMWVCVSQDFGVKRITEKIIKSITKKECPNLEMDQLQACLREQLEGKRYLLVLDDVWNENAEKWEKLKDLLIGGARGSKIMVTTRSEKVASIMRTVSTYHLSGLTDDDCWKLFKHRAFETGQEQEHQKLAEIGKDIVRKCGGVPLAAKALGSLMHSKTEEHEWVRVKENDVWGLSQEITGILPALMLSYNHLPFYLRQCFAYCSIYPKGYRIGKEDLILSWIAQGFVHSSGRSQFLEDIGCEYVKELMWGSFFQEPQVDCFGNLVSFTVHDLVHNVAQFVAGTECFIVEGETKNDIPEGVRHLSITEDNLSIGLLSSFSEKSNLRSLYLNTKVFIGGILPRFRCLRALSLQLESCNVPTSIGKLKHLRYLEICSESIVVIPNSFCKLQSLETLRLYCSKLRELPRDIRKMTKLRHIDLDESSSLTHMPSGLGHLTSLRTLPLFVPGKKIGCKLNELHALIHIAGRLTIQNLENVNNFRDSAKANLKGKENLQILKLFWNEMGDQEVDREEIAFHVLGNLEPSQNIKRLKINGYGNQRLPRWMMQPLLPNLMKVTLSGCRKCQHLPPFGQLPSLKVLKLEKMDALQFIEGSLVGRSRECFSSLERVFLRSIPNLENWIQIKEEEKSLLSLPRLAQLVVWDCPKLTSMPLLPSLEELNVGKCRERLIHSLLKVITWDSTISLCSYSLANLKHLKIGECDDLVCWPEVGLQGLTSLESLMIAFCPRMTNLPEEGLRGMTSLQRLTILDCESLNSLSGMRYLTALQDLSLVRCKEVHILDDMDDLASLDTLHIETIPKLVSLPEGLRNATSMQTIAVVDCEDLMVLPDCLGNFTSLQQLQVSRCPKLEAFPNEMSYPTTLQHLVISCCEGLKIWPNGLGNLKSLQGLGISCSSSLPSLPEEMQHLSTLRTLSLGGCKGFTTLPDWLINFTSLQQLEIYDFPDLKCLPEWMQSFPALQELYIFQCGHLTSRCRKEKGEDW

Seg: seg
94-105 seg

SNFFSLSNSILF

superfamily: SSF52540
144-394 P-loop containing nucleoside triphosphate hydrolases

DDNVEREHTHSYVVESKIFGRDVDKENVVELLLDLNPQDNPSVIPIQGMGGLGKTTLAQLLYNDSRIKVAFKQKMWVCVSQDFGVKRITEKIIKSITKKECPNLEMDQLQACLREQLEGKRYLLVLDDVWNENAEKWEKLKDLLIGGARGSKIMVTTRSEKVASIMRTVSTYHLSGLTDDDCWKLFKHRAFETGQEQEHQKLAEIGKDIVRKCGGVPLAAKALGSLMHSKTEEHEWVRVKENDVWGLSQEI

Gene3D: G3DSA:3.40.50.300
162-306 no description

FGRDVDKENVVELLLDLNPQDNPSVIPIQGMGGLGKTTLAQLLYNDSRIKVAFKQKMWVCVSQDFGVKRITEKIIKSITKKECPNLEMDQLQACLREQLEGKRYLLVLDDVWNENAEKWEKLKDLLIGGARGSKIMVTTRSEKVA

HMMPfam: PF00931
IPR002182
167-446 NB-ARC,NBS
NB-ARC

DKENVVELLLDLNPQDNPSVIPIQGMGGLGKTTLAQLLYNDSRIKVAFKQKMWVCVSQDFGVKRITEKIIKSITKKECPNLEMDQLQACLREQLEGKRYLLVLDDVWNENAEKWEKLKDLLIGGARGSKIMVTTRSEKVASIMRTVSTYHLSGLTDDDCWKLFKHRAFETGQEQEHQKLAEIGKDIVRKCGGVPLAAKALGSLMHSKTEEHEWVRVKENDVWGLSQEITGILPALMLSYNHLPFYLRQCFAYCSIYPKGYRIGKEDLILSWIAQGFVHSS

FPrintScan: PR00364
IPR000767
186-201 DISEASERSIST
Disease resistance protein

VIPIQGMGGLGKTTLA

Seg: seg
231-243 seg

ITEKIIKSITKKE

FPrintScan: PR00364
IPR000767
259-273 DISEASERSIST
Disease resistance protein

QLEGKRYLLVLDDVW

FPrintScan: PR00364
IPR000767
356-370 DISEASERSIST
Disease resistance protein

CGGVPLAAKALGSLM

superfamily: SSF52058
468-895 L domain-like,LRR

FFQEPQVDCFGNLVSFTVHDLVHNVAQFVAGTECFIVEGETKNDIPEGVRHLSITEDNLSIGLLSSFSEKSNLRSLYLNTKVFIGGILPRFRCLRALSLQLESCNVPTSIGKLKHLRYLEICSESIVVIPNSFCKLQSLETLRLYCSKLRELPRDIRKMTKLRHIDLDESSSLTHMPSGLGHLTSLRTLPLFVPGKKIGCKLNELHALIHIAGRLTIQNLENVNNFRDSAKANLKGKENLQILKLFWNEMGDQEVDREEIAFHVLGNLEPSQNIKRLKINGYGNQRLPRWMMQPLLPNLMKVTLSGCRKCQHLPPFGQLPSLKVLKLEKMDALQFIEGSLVGRSRECFSSLERVFLRSIPNLENWIQIKEEEKSLLSLPRLAQLVVWDCPKLTSMPLLPSLEELNVGKCRERLIHSLLKVITWDSTIS

Gene3D: G3DSA:3.80.10.10
510-657 no description

NDIPEGVRHLSITEDNLSIGLLSSFSEKSNLRSLYLNTKVFIGGILPRFRCLRALSLQLESCNVPTSIGKLKHLRYLEICSESIVVIPNSFCKLQSLETLRLYCSKLRELPRDIRKMTKLRHIDLDESSSLTHMPSGLGHLTSLRTLP

FPrintScan: PR00364
IPR000767
624-640 DISEASERSIST
Disease resistance protein

RKMTKLRHIDLDESSSL

Gene3D: G3DSA:3.80.10.10
834-981 no description

QIKEEEKSLLSLPRLAQLVVWDCPKLTSMPLLPSLEELNVGKCRERLIHSLLKVITWDSTISLCSYSLANLKHLKIGECDDLVCWPEVGLQGLTSLESLMIAFCPRMTNLPEEGLRGMTSLQRLTILDCESLNSLSGMRYLTALQDLS

superfamily: SSF52058
901-1196 L domain-like,LRR

LANLKHLKIGECDDLVCWPEVGLQGLTSLESLMIAFCPRMTNLPEEGLRGMTSLQRLTILDCESLNSLSGMRYLTALQDLSLVRCKEVHILDDMDDLASLDTLHIETIPKLVSLPEGLRNATSMQTIAVVDCEDLMVLPDCLGNFTSLQQLQVSRCPKLEAFPNEMSYPTTLQHLVISCCEGLKIWPNGLGNLKSLQGLGISCSSSLPSLPEEMQHLSTLRTLSLGGCKGFTTLPDWLINFTSLQQLEIYDFPDLKCLPEWMQSFPALQELYIFQCGHLTSRCRKEKGEDWPKIAG

Gene3D: G3DSA:3.80.10.10
982-1176 no description

LVRCKEVHILDDMDDLASLDTLHIETIPKLVSLPEGLRNATSMQTIAVVDCEDLMVLPDCLGNFTSLQQLQVSRCPKLEAFPNEMSYPTTLQHLVISCCEGLKIWPNGLGNLKSLQGLGISCSSSLPSLPEEMQHLSTLRTLSLGGCKGFTTLPDWLINFTSLQQLEIYDFPDLKCLPEWMQSFPALQELYIFQC

Seg: seg
1104-1113 seg

SSSLPSLPEE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox