PRGDB00206983 (Aquca_005_00427.1)

From PRG Wiki
Jump to: navigation, search
Aquca_005_00427.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLK-GNK2
Domain Type Ser-Thr Kinase, GNK2
Gene Species Aquilegia coerulea

Comment?

DNA Sequence

ATGTTCATAACATATACAACAGTACAACACCACAAGTCACAAACAAAGAAAGCTCAATGGTGGTTTGCTTTAGGAGGTAATTACACTTCAAACAGTGTTTATCAATCAAATCTAGACCGTGTGCTCTCTTCTCTTTCATCTAATAGAACATCCAACAACACAAGATTCTATAATAATGCTACCGTGGGAAGGGATCCGGATAGAGTCTATGGGATTTATCAGTGCAGAGGTGATGTTGCATTTGATGTTTGCAAGAATTGTGTGGAAACAGCAGCTGAAGAGGTTACAAGAAATAGGTGTCCATTTAAAAAAGAAGCTATTCTATTGTATGACGAGTGTATGCTACGCTACTCCAACAATTCCTTCATATCTGTTAGGCAGGAGAGTCCTACTCTCTATATGAGGAATCCGAACAACGTTACTGATGCAAATCTTTTTAACTCGATACTGTCTACGTTAATGGACAACCTAGTGGTACAAGCTGTTTCTGCAGATTCTAGTAATATGTTTGCAACTAGATCTGCAAATCTTAGTTTCTTTGAGAATATATATGGACTTGTTCAGTGCACTGAAGATATAACAAGAACTGATTGTAGGAACTGCTTAATAAGTGCTATTACTGAGATTCCAAGTTGTTGTGATAACAAGAGAGGTGGAAGAGTTATTAAACCAAGTTGCAATTTTAGGTATGAAACATATCGGTTTTACGAATCTGAAGAAATTGCACCTATTCCTTCTCCTTCACCTCCACGGATTCCTCCGCCACCAAACACAAATGGCACTGAGAGTAGTAAAGAGCAGAAGAGTTCATCCAGAACAATTGTTATCATAGTAGTTCCAGTAATAATCGGAGTGGTACTTCTATTACTCATTGCAGTTTGTTTATATTCACGAAGAAAGAAGGAATTTGAGATAGTTAATGATGGGGATGAGATCATCAGTGTGGAATCCTTACAATTCAACTTTGAGACTGTGAGAGCTGCTACAGAGAACTTCTCTGATGCTAATAAGCTTGGAGAAGGTGGATTTGGTGCAGTTTACAAGGGAAAACTTTCTGATGGCCAAGAAATTGCTGTAAAAAGGCTCTCTAGAAACTCTGGTCAAGGTGTAGAAGAATTTAAGAATGAAGTTCTATTAGTAGCCAAACTTCAACATCGGAATCTTGTAAGGCTTTTAGGTTTCTGCTTGGAAGGAGATGAGAAGCTTCTGATTTACGAGTTCCTACCCAACACAAGCCTCGACCACTTTATATTTGATCCAGTAAAGCGCACGTATCTTGATTGGGAAAGACGTTACAACATCATAGGGGGAATTGCTAGAGGTCTTCTCTATCTACATGAGGATTCTCGTCACAGAATTATCCATCGAGATCTCAAAGCTAGCAATATTTTGTTAGATGCAGAAATGAATCCCAAAATCTCAGACTTTGGCATGGCAAGGCTTTTCGTGGTGGACCAAACTCAAGGAAATACCAATAGAATAGTCGGTACATTTGGATACATGTCTCCAGAGTATGCAATGCATGGACAATTTTCTGCGAAATCAGATGTTTTTAGTTTTGGTGTATTAGTTTTAGAGATAATAACTGGTCAGAAGAACACCTCTTTCTATCAGTCAGAAGCTCAAGACCTTATAAGCCATGTATGGAGACATTGGGAGAAAGGGACAGCTTTAGAGTTGATTGAACCATCACTAGAGGATCGTTATTCAAGAACAGAGGTTATGAGATGCATACACATTGGATTGTTATGTGTTCAAGATGAAATGGGAATGAGACCCACAATGGCGTCAGTTGTTCTTATGCTCAATAGCTATTCTGCAACTATGCCATTGCCTTCTACACCTGCATTCTTTGTTAGTACCATTAGGGAATCACACCAGAGAACTTGGGAGAATGAAGCATACACAAATTCGTCATGCCAGTCGGTGGTGCCAATTCCATCTAAGAGTAGGTCGGCGTCTGTTAATGAAGCATCCATTACTGAGTTATACCCTCGGTAA


Protein sequences

Name Description Sequence
Aquca_005_00427.1 protein obtained from Pythozome database for gene Aquca_005_00427.1

MFITYTTVQHHKSQTKKAQWWFALGGNYTSNSVYQSNLDRVLSSLSSNRTSNNTRFYNNATVGRDPDRVYGIYQCRGDVAFDVCKNCVETAAEEVTRNRCPFKKEAILLYDECMLRYSNNSFISVRQESPTLYMRNPNNVTDANLFNSILSTLMDNLVVQAVSADSSNMFATRSANLSFFENIYGLVQCTEDITRTDCRNCLISAITEIPSCCDNKRGGRVIKPSCNFRYETYRFYESEEIAPIPSPSPPRIPPPPNTNGTESSKEQKSSSRTIVIIVVPVIIGVVLLLLIAVCLYSRRKKEFEIVNDGDEIISVESLQFNFETVRAATENFSDANKLGEGGFGAVYKGKLSDGQEIAVKRLSRNSGQGVEEFKNEVLLVAKLQHRNLVRLLGFCLEGDEKLLIYEFLPNTSLDHFIFDPVKRTYLDWERRYNIIGGIARGLLYLHEDSRHRIIHRDLKASNILLDAEMNPKISDFGMARLFVVDQTQGNTNRIVGTFGYMSPEYAMHGQFSAKSDVFSFGVLVLEIITGQKNTSFYQSEAQDLISHVWRHWEKGTALELIEPSLEDRYSRTEVMRCIHIGLLCVQDEMGMRPTMASVVLMLNSYSATMPLPSTPAFFVSTIRESHQRTWENEAYTNSSCQSVVPIPSKSRSASVNEASITELYPR*

Domains

Domain Start-End Description Sequence

ProfileScan: PS51473
IPR002902
16-122 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

KKAQWWFALGGNYTSNSVYQSNLDRVLSSLSSNRTSNNTRFYNNATVGRDPDRVYGIYQCRGDVAFDVCKNCVETAAEEVTRNRCPFKKEAILLYDECMLRYSNNSF

HMMPanther: PTHR24420:SF430
21-633 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

WFALGGNYTSNSVYQSNLDRVLSSLSSNRTSNNTRFYNNATVGRDPDRVYGIYQCRGDVAFDVCKNCVETAAEEVTRNRCPFKKEAILLYDECMLRYSNNSFISVRQESPTLYMRNPNNVTDANLFNSILSTLMDNLVVQAVSADSSNMFATRSANLSFFENIYGLVQCTEDITRTDCRNCLISAITEIPSCCDNKRGGRVIKPSCNFRYETYRFYESEEIAPIPSPSPPRIPPPPNTNGTESSKEQKSSSRTIVIIVVPVIIGVVLLLLIAVCLYSRRKKEFEIVNDGDEIISVESLQFNFETVRAATENFSDANKLGEGGFGAVYKGKLSDGQEIAVKRLSRNSGQGVEEFKNEVLLVAKLQHRNLVRLLGFCLEGDEKLLIYEFLPNTSLDHFIFDPVKRTYLDWERRYNIIGGIARGLLYLHEDSRHRIIHRDLKASNILLDAEMNPKISDFGMARLFVVDQTQGNTNRIVGTFGYMSPEYAMHGQFSAKSDVFSFGVLVLEIITGQKNTSFYQSEAQDLISHVWRHWEKGTALELIEPSLEDRYSRTEVMRCIHIGLLCVQDEMGMRPTMASVVLMLNSYSATMPLPSTPAFFVSTIRESHQRTWENE

HMMPanther: PTHR24420
21-633 FAMILY NOT NAMED,FAMILY NOT NAMED

WFALGGNYTSNSVYQSNLDRVLSSLSSNRTSNNTRFYNNATVGRDPDRVYGIYQCRGDVAFDVCKNCVETAAEEVTRNRCPFKKEAILLYDECMLRYSNNSFISVRQESPTLYMRNPNNVTDANLFNSILSTLMDNLVVQAVSADSSNMFATRSANLSFFENIYGLVQCTEDITRTDCRNCLISAITEIPSCCDNKRGGRVIKPSCNFRYETYRFYESEEIAPIPSPSPPRIPPPPNTNGTESSKEQKSSSRTIVIIVVPVIIGVVLLLLIAVCLYSRRKKEFEIVNDGDEIISVESLQFNFETVRAATENFSDANKLGEGGFGAVYKGKLSDGQEIAVKRLSRNSGQGVEEFKNEVLLVAKLQHRNLVRLLGFCLEGDEKLLIYEFLPNTSLDHFIFDPVKRTYLDWERRYNIIGGIARGLLYLHEDSRHRIIHRDLKASNILLDAEMNPKISDFGMARLFVVDQTQGNTNRIVGTFGYMSPEYAMHGQFSAKSDVFSFGVLVLEIITGQKNTSFYQSEAQDLISHVWRHWEKGTALELIEPSLEDRYSRTEVMRCIHIGLLCVQDEMGMRPTMASVVLMLNSYSATMPLPSTPAFFVSTIRESHQRTWENE

HMMPfam: PF01657
IPR002902
26-122 Stress-antifung
Gnk2-homologous domain

GNYTSNSVYQSNLDRVLSSLSSNRTSNNTRFYNNATVGRDPDRVYGIYQCRGDVAFDVCKNCVETAAEEVTRNRCPFKKEAILLYDECMLRYSNNSF

Seg: seg
42-55 seg

LSSLSSNRTSNNTR

ProfileScan: PS51473
IPR002902
128-235 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

ESPTLYMRNPNNVTDANLFNSILSTLMDNLVVQAVSADSSNMFATRSANLSFFENIYGLVQCTEDITRTDCRNCLISAITEIPSCCDNKRGGRVIKPSCNFRYETYRF

HMMPfam: PF01657
IPR002902
138-235 Stress-antifung
Gnk2-homologous domain

NNVTDANLFNSILSTLMDNLVVQAVSADSSNMFATRSANLSFFENIYGLVQCTEDITRTDCRNCLISAITEIPSCCDNKRGGRVIKPSCNFRYETYRF

Seg: seg
237-256 seg

ESEEIAPIPSPSPPRIPPPP

Seg: seg
274-291 seg

IVIIVVPVIIGVVLLLLI

superfamily: SSF56112
IPR011009
304-625 Protein kinase-like (PK-like)
Protein kinase-like domain

EIVNDGDEIISVESLQFNFETVRAATENFSDANKLGEGGFGAVYKGKLSDGQEIAVKRLSRNSGQGVEEFKNEVLLVAKLQHRNLVRLLGFCLEGDEKLLIYEFLPNTSLDHFIFDPVKRTYLDWERRYNIIGGIARGLLYLHEDSRHRIIHRDLKASNILLDAEMNPKISDFGMARLFVVDQTQGNTNRIVGTFGYMSPEYAMHGQFSAKSDVFSFGVLVLEIITGQKNTSFYQSEAQDLISHVWRHWEKGTALELIEPSLEDRYSRTEVMRCIHIGLLCVQDEMGMRPTMASVVLMLNSYSATMPLPSTPAFFVSTIRES

Gene3D: G3DSA:3.30.200.20
319-393 no description

QFNFETVRAATENFSDANKLGEGGFGAVYKGKLSDGQEIAVKRLSRNSGQGVEEFKNEVLLVAKLQHRNLVRLLG

ProfileScan: PS50011
IPR000719
332-582 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDANKLGEGGFGAVYKGKLSDGQEIAVKRLSRNSGQGVEEFKNEVLLVAKLQHRNLVRLLGFCLEGDEKLLIYEFLPNTSLDHFIFDPVKRTYLDWERRYNIIGGIARGLLYLHEDSRHRIIHRDLKASNILLDAEMNPKISDFGMARLFVVDQTQGNTNRIVGTFGYMSPEYAMHGQFSAKSDVFSFGVLVLEIITGQKNTSFYQSEAQDLISHVWRHWEKGTALELIEPSLEDRYSRTEVMRCIHIGL

HMMSmart: SM00220
IPR002290
332-578 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSDANKLGEGGFGAVYKGKLSDGQEIAVKRLSRNSGQGVEEFKNEVLLVAKLQHRNLVRLLGFCLEGDEKLLIYEFLPNTSLDHFIFDPVKRTYLDWERRYNIIGGIARGLLYLHEDSRHRIIHRDLKASNILLDAEMNPKISDFGMARLFVVDQTQGNTNRIVGTFGYMSPEYAMHGQFSAKSDVFSFGVLVLEIITGQKNTSFYQSEAQDLISHVWRHWEKGTALELIEPSLEDRYSRTEVMRCI

HMMSmart: SM00219
IPR020635
332-602 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSDANKLGEGGFGAVYKGKLSDGQEIAVKRLSRNSGQGVEEFKNEVLLVAKLQHRNLVRLLGFCLEGDEKLLIYEFLPNTSLDHFIFDPVKRTYLDWERRYNIIGGIARGLLYLHEDSRHRIIHRDLKASNILLDAEMNPKISDFGMARLFVVDQTQGNTNRIVGTFGYMSPEYAMHGQFSAKSDVFSFGVLVLEIITGQKNTSFYQSEAQDLISHVWRHWEKGTALELIEPSLEDRYSRTEVMRCIHIGLLCVQDEMGMRPTMASVVLML

HMMPfam: PF00069
IPR000719
335-548 Pkinase,Ser-thr
Protein kinase, catalytic domain

ANKLGEGGFGAVYKGKLSDGQEIAVKRLSRNSGQGVEEFKNEVLLVAKLQHRNLVRLLGFCLEGDEKLLIYEFLPNTSLDHFIFDPVKRTYLDWERRYNIIGGIARGLLYLHEDSRHRIIHRDLKASNILLDAEMNPKISDFGMARLFVVDQTQGNTNRIVGTFGYMSPEYAMHGQFSAKSDVFSFGVLVLEIITGQKNTSFYQSEAQDLISHV

PatternScan: PS00107
IPR017441
338-360 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGAVYKGKLSDGQEIAVK

Gene3D: G3DSA:1.10.510.10
394-564 no description

FCLEGDEKLLIYEFLPNTSLDHFIFDPVKRTYLDWERRYNIIGGIARGLLYLHEDSRHRIIHRDLKASNILLDAEMNPKISDFGMARLFVVDQTQGNTNRIVGTFGYMSPEYAMHGQFSAKSDVFSFGVLVLEIITGQKNTSFYQSEAQDLISHVWRHWEKGTALELIEPS

PatternScan: PS00108
IPR008271
453-465 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox