PRGDB00206984 (Aquca_005_00064.1)

From PRG Wiki
Jump to: navigation, search
Aquca_005_00064.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Aquilegia coerulea

Comment?

DNA Sequence

ATGTCTTTCTCTCACCAGCCAAAAATGCAGGAGGAAGTCATTGACACGCTTATGCCTTTGGTATTAAGTGGAACAAATAATACTCATGGAAGTGATCAAGCACAAAGTATTCAAGGGAATGAAAATGCGTGTGAAGGTGAAGTAGAACATGGTGGAGGTCATGATAATCGTGACACTCAGAACTTGCTTCTTGATAATATCGTGGATAGTAGGATCCAAGAAACATGGAAAAATAAAGGAAAACAACCAATGGAGAGGTTGGAGTTATCTGCACAAAACATTTTACACGAAGAAGATGAGATCAGAATAGCTGAGCAAGAGAAATACGGGGTGGAATACTTGGTACCATCAGCACAGAAAAATATCGAGACACTATGGAAATGTTTGAATAATGCGAGTATTCGAACCATAGGGCTTGAAGGCATTGGGGGCATTGGGAAAAGATGGACTGTGAGCCATGTAGTGGAAAGAGCACTTGTAGCCAATCATTTTGATTTCATCATCTGGGTCAATTTGCAGTCTAGGTCTAGACCGATGCTGAATCAAATCGTGGATCAGTTGAATTTGCTTAGTACAACTACGGAGAATGATGACGGAAAAGAAGTCAGCGATTTGGAGCTAATGGAGGGGATCTCAAAGACACTGGCTGGGAAGAGTTACTTGCTGATTCTACGCGATATCCAGCATCATTCTGGAAGCACTCTGTCTGATCTAGGAGTACCACATCCAAACACCCAGAAACCATCCAAAGTGTTATTTCTTGGGGCTAGGTATTGGTTTCAACAAAACAATATAGATCAGGTCTTGACCTTCAAACATTTACCCAAAGACGAAGCCTGGCTTTTGTTCTGTGAAAAAACTGGCTCACAGTTTGATTCTCCAGGTATGCATGAACTTGCTGAAACTTTACTCGAATCATGTGGAGGTCTTCCACTTAAAATTGTTACACTAGCAGGAGCTTTGAGGAATGTCAAGGGACCAACTAGTGCGAGATTGATGGAAAATGTACAAAAAGCTTATAAACTAATTATCAGTCGCTCTATGTATCATTATGAGGCTATGTTTAATATGTTGCCGAGCAAGGAAGTGAAAGATTGCATTGTGTACTGCAGCAGCTATCATCTATACTATCATATCAGTGTGAAAGGATTGATTACATCTTGGATAGCTGAAGGACTTCTAGATGAATGTAACTGTTTAGAGGCAGCGCATGAGAAGGCTCAGAAAATAATAAAGGATCTCATTGATCGGCACCTTCTCATTAGATATGATGATAGGCACGTGATAATGAATTACGATGTACGCCTCTGTTTTTCATCTATGATCCATATTTTATTGGAAAAGGCTGGTAGAAGTATGAGGCTAACTGTTCCTGAGCTATTTACGGAACATGAGAGCTTCAGAATGATCTCTATGATGAATGAGAGTTTTGAAATCAAGTACCCCAGCTATGCCACAAAATCCTCCAGTAAATCCTCAACTTTGTTGCTGTATGGAAAGGATGGTTGCCTCCCTGGCGAAATTCCAGATGCCTTCTTTGCGAAAACAAACCATCTTCAATTTCTCTCCATTCTCCATGCTGGCATCAGGTATCTTCCATCATCTCTTTCAAACTTGAAAAATGTTTGTGCTCTTGTGGTCAGAGGTTGTATCGCTTTAGACAATGTGGATACCATTAGAGAACTCCACTGCTTGGTGGTTCTCAATCTTTCGGGTGCTAGCTCCTTGATGGAACTCCCAGATGACTTCTTTGAACATATGCAACTTCTTCAATGCCTGGACCTCTCAGAATCCCAGCTAAAACAGCTGCCCTCATCCTTTTCAAACCTTGGAAATATCCAACGTCTCATCCTTAGAGGATGCTCCTACTTGAAAACGCTGCCGCGTCACGTAGGAGATAAACTCATCGTGCTGGATTTATCAGGGGCTACTGCTCTGGGGGAAATCCCAAATGAATTCATTGAAAAACAAAGGTCCCTACAATTACTTGACCTGTCTGGAACTGTTGTTGACCGATTAATATATCCAAATGGCGTACATAGGGATCTAAGGTACCTCTTTTTGAAAGGTTCACGAATTAAGACATTGCCCCATCCAGAGGCATTTGTGAAGCTGCAGGAACTTGATCTATCAGGTGCCAGTGAATTTAAGGAATTTCAATCCATAACCTCATCTTCTAACAGGTCCATAAAAAAAATTGATTTGTCTAAAACTCAGATTGTCAGCCTACCAAATCTTTCTAAATATCCTAACCTCTGTCAACTCTGTTTGAAAAGTTGTGTATACCTAGAGGAACTTCCACATTTAGAACTGAAAAAACTTCAAGTTCTCGATCTTTCTGGTTCTACGAATTTCAGAAGGTTCCAGGATGATTCCTTTGGGAATATGGACCAACTGGAAATAATTGACTTCTCTGGAACAAAGATCACAAAACTACCATCTGTTTCTGAATGCCTTAAACTCCGTCATCTCTTACTGAAAGGTTGTGAATACCTAATGGAGCTACCACCTTTCCAACTTGAAAATCTTGAAATTCTCAATCTTTCTGGAACCCAGGTAGTAAAGTTGCCGAACCTTTCCAAATGTTGCTTTCTCAGTGAACTACTACTAAGAAAATGTACAAAATTGGTGACCATACCACACTTAGAAGCTCTTGAAAGGCTTGAAGTGCTTGATCTCTCAGGGGCTACTTCTTTAAAGAAATTTCAATACAAACCTATTGAGGTTAATTCCTCGACATTTTCGCATTGTATTGATTGCATCCGTAACTTTCAAAAACTTGACCTCACTACATCTCCATTAGAAATCTCACCCTCGTCTCTGCCAGAACTCGAGAACCTACCTCAGCTCTTTCTGAGAGGTTGTTCATGCTCACTGTTGCAGCCCCATCCAGAAATGCCCAGAAATTATGAAGTGCTTGACTTTTCATGCATGCAAATTAGATATTTTTCTGATGGCAGCTCAAAATGGACTGATCTAAGGTTTCTTGGAATGTTGAATCAAAAGCACCTCTGGGACTTTGATTATGGAAACACGGAGGAGGTGAGTAAGCATCTGAAGTTTGATCAACACGAAGCAGATGATGTTGGAATAACTGCCATACGAATAATATCGAGTAACATCAATCAGTTCAATTTCATGAAGAATAATTCTCAAATGTGGGAGAGAGACTTCCAGAAATTCCATTATTGCCTCTGCTCTCCCAAGGAGTGGGAGAAAGAGAAGGATATTTACTTGCATCAGAGAAGAGTTGTCTTCAAAGATATCTACTACCAGGTCAGTCAGATTCCTCATTCAACAGCTCCAGACCATGTTTTTGAGATATGTGGCTTTGAACTCTTCCCTGTAATAATCGATGAGGTCCTCGGTCATGTGAAAATATTATACTTAAAAAAGAATTCTTTCATCACACGACTATCGGATTTGGGTGCTGGAAATGATATGGTAATGAGAGAATTGTGGATAGAGAGATGTGAGAGCATGGAGTGTGCTTTCTATGGAGACGAGATGAAAGAAAATCTGGCATTAGGGAGATTTTTAGAGAATCTTTGGGTCTCAAATCTCTCTAAACTAAGGAGTTTGTTCTTGGGAGAGATGCAGCCCAAGAGCTTTACATGCCTGAAGCATTTATCTATCGATTGTTGCCCAAGCCTCATCACTGTTTTCTCCTCACATCTGGAACTAGTTAGCCTTGAAACTCTTAAGATCAAATTTTGTGATAAAGTGCAGAACATATTTGGTGAATCAGAGTCCGGAGAACAAACACTCCCAAAGTTAAACACATTGACACTTTGGAGGCTATCACAGCTGCAGAATATTTGTCGAGGTGGATTGCCATCTCTAAAAAATGTCAGAGTCAAAGGATGCTCGAAGCTGTTAAAACTTCCAGTCAGTGCAAGCAATGTGAGTTCAGTGATAGACATCAGAGGAGAAGCGATATGGTGGAACAATTTGGTATGGGAAGATAAAAGCATTATGTCCCGGTTGTCCTTTACAGAGTTACGCAGATTCTTATAG


Protein sequences

Name Description Sequence
Aquca_005_00064.1 protein obtained from Pythozome database for gene Aquca_005_00064.1

MSFSHQPKMQEEVIDTLMPLVLSGTNNTHGSDQAQSIQGNENACEGEVEHGGGHDNRDTQNLLLDNIVDSRIQETWKNKGKQPMERLELSAQNILHEEDEIRIAEQEKYGVEYLVPSAQKNIETLWKCLNNASIRTIGLEGIGGIGKRWTVSHVVERALVANHFDFIIWVNLQSRSRPMLNQIVDQLNLLSTTTENDDGKEVSDLELMEGISKTLAGKSYLLILRDIQHHSGSTLSDLGVPHPNTQKPSKVLFLGARYWFQQNNIDQVLTFKHLPKDEAWLLFCEKTGSQFDSPGMHELAETLLESCGGLPLKIVTLAGALRNVKGPTSARLMENVQKAYKLIISRSMYHYEAMFNMLPSKEVKDCIVYCSSYHLYYHISVKGLITSWIAEGLLDECNCLEAAHEKAQKIIKDLIDRHLLIRYDDRHVIMNYDVRLCFSSMIHILLEKAGRSMRLTVPELFTEHESFRMISMMNESFEIKYPSYATKSSSKSSTLLLYGKDGCLPGEIPDAFFAKTNHLQFLSILHAGIRYLPSSLSNLKNVCALVVRGCIALDNVDTIRELHCLVVLNLSGASSLMELPDDFFEHMQLLQCLDLSESQLKQLPSSFSNLGNIQRLILRGCSYLKTLPRHVGDKLIVLDLSGATALGEIPNEFIEKQRSLQLLDLSGTVVDRLIYPNGVHRDLRYLFLKGSRIKTLPHPEAFVKLQELDLSGASEFKEFQSITSSSNRSIKKIDLSKTQIVSLPNLSKYPNLCQLCLKSCVYLEELPHLELKKLQVLDLSGSTNFRRFQDDSFGNMDQLEIIDFSGTKITKLPSVSECLKLRHLLLKGCEYLMELPPFQLENLEILNLSGTQVVKLPNLSKCCFLSELLLRKCTKLVTIPHLEALERLEVLDLSGATSLKKFQYKPIEVNSSTFSHCIDCIRNFQKLDLTTSPLEISPSSLPELENLPQLFLRGCSCSLLQPHPEMPRNYEVLDFSCMQIRYFSDGSSKWTDLRFLGMLNQKHLWDFDYGNTEEVSKHLKFDQHEADDVGITAIRIISSNINQFNFMKNNSQMWERDFQKFHYCLCSPKEWEKEKDIYLHQRRVVFKDIYYQVSQIPHSTAPDHVFEICGFELFPVIIDEVLGHVKILYLKKNSFITRLSDLGAGNDMVMRELWIERCESMECAFYGDEMKENLALGRFLENLWVSNLSKLRSLFLGEMQPKSFTCLKHLSIDCCPSLITVFSSHLELVSLETLKIKFCDKVQNIFGESESGEQTLPKLNTLTLWRLSQLQNICRGGLPSLKNVRVKGCSKLLKLPVSASNVSSVIDIRGEAIWWNNLVWEDKSIMSRLSFTELRRFL*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
55-1322 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DNRDTQNLLLDNIVDSRIQETWKNKGKQPMERLELSAQNILHEEDEIRIAEQEKYGVEYLVPSAQKNIETLWKCLNNASIRTIGLEGIGGIGKRWTVSHVVERALVANHFDFIIWVNLQSRSRPMLNQIVDQLNLLSTTTENDDGKEVSDLELMEGISKTLAGKSYLLILRDIQHHSGSTLSDLGVPHPNTQKPSKVLFLGARYWFQQNNIDQVLTFKHLPKDEAWLLFCEKTGSQFDSPGMHELAETLLESCGGLPLKIVTLAGALRNVKGPTSARLMENVQKAYKLIISRSMYHYEAMFNMLPSKEVKDCIVYCSSYHLYYHISVKGLITSWIAEGLLDECNCLEAAHEKAQKIIKDLIDRHLLIRYDDRHVIMNYDVRLCFSSMIHILLEKAGRSMRLTVPELFTEHESFRMISMMNESFEIKYPSYATKSSSKSSTLLLYGKDGCLPGEIPDAFFAKTNHLQFLSILHAGIRYLPSSLSNLKNVCALVVRGCIALDNVDTIRELHCLVVLNLSGASSLMELPDDFFEHMQLLQCLDLSESQLKQLPSSFSNLGNIQRLILRGCSYLKTLPRHVGDKLIVLDLSGATALGEIPNEFIEKQRSLQLLDLSGTVVDRLIYPNGVHRDLRYLFLKGSRIKTLPHPEAFVKLQELDLSGASEFKEFQSITSSSNRSIKKIDLSKTQIVSLPNLSKYPNLCQLCLKSCVYLEELPHLELKKLQVLDLSGSTNFRRFQDDSFGNMDQLEIIDFSGTKITKLPSVSECLKLRHLLLKGCEYLMELPPFQLENLEILNLSGTQVVKLPNLSKCCFLSELLLRKCTKLVTIPHLEALERLEVLDLSGATSLKKFQYKPIEVNSSTFSHCIDCIRNFQKLDLTTSPLEISPSSLPELENLPQLFLRGCSCSLLQPHPEMPRNYEVLDFSCMQIRYFSDGSSKWTDLRFLGMLNQKHLWDFDYGNTEEVSKHLKFDQHEADDVGITAIRIISSNINQFNFMKNNSQMWERDFQKFHYCLCSPKEWEKEKDIYLHQRRVVFKDIYYQVSQIPHSTAPDHVFEICGFELFPVIIDEVLGHVKILYLKKNSFITRLSDLGAGNDMVMRELWIERCESMECAFYGDEMKENLALGRFLENLWVSNLSKLRSLFLGEMQPKSFTCLKHLSIDCCPSLITVFSSHLELVSLETLKIKFCDKVQNIFGESESGEQTLPKLNTLTLWRLSQLQNICRGGLPSLKNVRVKGCSKLLKLPVSASNVSSVIDIRGEAIWWNNLVWED

Coil: coil
87-108 coiled-coil

LELSAQNILHEEDEIRIAEQEK

HMMPfam: PF00931
IPR002182
119-394 NB-ARC,NBS
NB-ARC

QKNIETLWKCLNNASIRTIGLEGIGGIGKRWTVSHVVERALVANHFDFIIWVNLQSRSRPMLNQIVDQLNLLSTTTENDDGKEVSDLELMEGISKTLAGKSYLLILRDIQHHSGSTLSDLGVPHPNTQKPSKVLFLGARYWFQQNNIDQVLTFKHLPKDEAWLLFCEKTGSQFDSPGMHELAETLLESCGGLPLKIVTLAGALRNVKGPTSARLMENVQKAYKLIISRSMYHYEAMFNMLPSKEVKDCIVYCSSYHLYYHISVKGLITSWIAEGLL

superfamily: SSF52540
122-323 P-loop containing nucleoside triphosphate hydrolases

IETLWKCLNNASIRTIGLEGIGGIGKRWTVSHVVERALVANHFDFIIWVNLQSRSRPMLNQIVDQLNLLSTTTENDDGKEVSDLELMEGISKTLAGKSYLLILRDIQHHSGSTLSDLGVPHPNTQKPSKVLFLGARYWFQQNNIDQVLTFKHLPKDEAWLLFCEKTGSQFDSPGMHELAETLLESCGGLPLKIVTLAGALRN

FPrintScan: PR00364
IPR000767
136-151 DISEASERSIST
Disease resistance protein

TIGLEGIGGIGKRWTV

FPrintScan: PR00364
IPR000767
214-228 DISEASERSIST
Disease resistance protein

TLAGKSYLLILRDIQ

FPrintScan: PR00364
IPR000767
307-321 DISEASERSIST
Disease resistance protein

CGGLPLKIVTLAGAL

Coil: coil
390-418 coiled-coil

AEGLLDECNCLEAAHEKAQKIIKDLIDRH

superfamily: SSF52058
468-767 L domain-like,LRR

RMISMMNESFEIKYPSYATKSSSKSSTLLLYGKDGCLPGEIPDAFFAKTNHLQFLSILHAGIRYLPSSLSNLKNVCALVVRGCIALDNVDTIRELHCLVVLNLSGASSLMELPDDFFEHMQLLQCLDLSESQLKQLPSSFSNLGNIQRLILRGCSYLKTLPRHVGDKLIVLDLSGATALGEIPNEFIEKQRSLQLLDLSGTVVDRLIYPNGVHRDLRYLFLKGSRIKTLPHPEAFVKLQELDLSGASEFKEFQSITSSSNRSIKKIDLSKTQIVSLPNLSKYPNLCQLCLKSCVYLEELP

Seg: seg
486-497 seg

TKSSSKSSTLLL

Gene3D: G3DSA:3.80.10.10
509-697 no description

PDAFFAKTNHLQFLSILHAGIRYLPSSLSNLKNVCALVVRGCIALDNVDTIRELHCLVVLNLSGASSLMELPDDFFEHMQLLQCLDLSESQLKQLPSSFSNLGNIQRLILRGCSYLKTLPRHVGDKLIVLDLSGATALGEIPNEFIEKQRSLQLLDLSGTVVDRLIYPNGVHRDLRYLFLKGSRIKTLP

HMMSmart: SM00369
IPR003591
562-586 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LHCLVVLNLSGASSLMELPDDFFEH

HMMPfam: PF13855
566-621 LRR_8,Leucine rich repeat

VVLNLSGASSLMELPDDFFEHMQLLQCLDLSESQLKQLPSSFSNLGNIQRLILRGC

HMMSmart: SM00369
IPR003591
587-609 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MQLLQCLDLSESQLKQLPSSFSN

ProfileScan: PS51450
IPR001611
589-610 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLQCLDLSESQLKQLPSSFSNL

ProfileScan: PS51450
IPR001611
682-703 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLRYLFLKGSRIKTLPHPEAFV

Gene3D: G3DSA:3.80.10.10
698-890 no description

HPEAFVKLQELDLSGASEFKEFQSITSSSNRSIKKIDLSKTQIVSLPNLSKYPNLCQLCLKSCVYLEELPHLELKKLQVLDLSGSTNFRRFQDDSFGNMDQLEIIDFSGTKITKLPSVSECLKLRHLLLKGCEYLMELPPFQLENLEILNLSGTQVVKLPNLSKCCFLSELLLRKCTKLVTIPHLEALERLEV

ProfileScan: PS51450
IPR001611
729-750 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIKKIDLSKTQIVSLPNLSKYP

Seg: seg
763-774 seg

LEELPHLELKKL

FPrintScan: PR00364
IPR000767
769-785 DISEASERSIST
Disease resistance protein

LELKKLQVLDLSGSTNF

HMMSmart: SM00369
IPR003591
771-795 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKKLQVLDLSGSTNFRRFQDDSFGN

superfamily: SSF52058
772-1290 L domain-like,LRR

KKLQVLDLSGSTNFRRFQDDSFGNMDQLEIIDFSGTKITKLPSVSECLKLRHLLLKGCEYLMELPPFQLENLEILNLSGTQVVKLPNLSKCCFLSELLLRKCTKLVTIPHLEALERLEVLDLSGATSLKKFQYKPIEVNSSTFSHCIDCIRNFQKLDLTTSPLEISPSSLPELENLPQLFLRGCSCSLLQPHPEMPRNYEVLDFSCMQIRYFSDGSSKWTDLRFLGMLNQKHLWDFDYGNTEEVSKHLKFDQHEADDVGITAIRIISSNINQFNFMKNNSQMWERDFQKFHYCLCSPKEWEKEKDIYLHQRRVVFKDIYYQVSQIPHSTAPDHVFEICGFELFPVIIDEVLGHVKILYLKKNSFITRLSDLGAGNDMVMRELWIERCESMECAFYGDEMKENLALGRFLENLWVSNLSKLRSLFLGEMQPKSFTCLKHLSIDCCPSLITVFSSHLELVSLETLKIKFCDKVQNIFGESESGEQTLPKLNTLTLWRLSQLQNICRGGLPSLKNVRVKGCS

HMMPfam: PF13855
773-829 LRR_8,Leucine rich repeat

KLQVLDLSGSTNFRRFQDDSFGNMDQLEIIDFSGTKITKLPSVSECLKLRHLLLKGC

HMMSmart: SM00369
IPR003591
796-819 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MDQLEIIDFSGTKITKLPSVSECL

ProfileScan: PS51450
IPR001611
798-819 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLEIIDFSGTKITKLPSVSECL

HMMSmart: SM00369
IPR003591
840-862 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LENLEILNLSGTQVVKLPNLSKC

ProfileScan: PS51450
IPR001611
842-863 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEILNLSGTQVVKLPNLSKCC

HMMPfam: PF00560
IPR001611
842-862 LRR_1
Leucine-rich repeat

NLEILNLSGTQVVKLPNLSKC

Seg: seg
932-948 seg

SPLEISPSSLPELENLP

Gene3D: G3DSA:3.80.10.10
1186-1303 no description

SNLSKLRSLFLGEMQPKSFTCLKHLSIDCCPSLITVFSSHLELVSLETLKIKFCDKVQNIFGESESGEQTLPKLNTLTLWRLSQLQNICRGGLPSLKNVRVKGCSKLLKLPVSASNVS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox