PRGDB00206985 (Aquca_005_00064.2)

From PRG Wiki
Jump to: navigation, search
Aquca_005_00064.2
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Aquilegia coerulea

Comment?

DNA Sequence

ATGCCTTTGGTATTAAGTGGAACAAATAATACTCATGGAAGTGATCAAGCACAAAGTATTCAAGGGAATGAAAATGCGTGTGAAGGTGAAGTAGAACATGGTGGAGGTCATGATAATCGTGACACTCAGAACTTGCTTCTTGATAATATCGTGGATAGTAGGATCCAAGAAACATGGAAAAATAAAGGAAAACAACCAATGGAGAGGTTGGAGTTATCTGCACAAAACATTTTACACGAAGAAGATGAGATCAGAATAGCTGAGCAAGAGAAATACGGGGTGGAATACTTGGTACCATCAGCACAGAAAAATATCGAGACACTATGGAAATGTTTGAATAATGCGAGTATTCGAACCATAGGGCTTGAAGGCATTGGGGGCATTGGGAAAAGATGGACTGTGAGCCATGTAGTGGAAAGAGCACTTGTAGCCAATCATTTTGATTTCATCATCTGGGTCAATTTGCAGTCTAGGTCTAGACCGATGCTGAATCAAATCGTGGATCAGTTGAATTTGCTTAGTACAACTACGGAGAATGATGACGGAAAAGAAGTCAGCGATTTGGAGCTAATGGAGGGGATCTCAAAGACACTGGCTGGGAAGAGTTACTTGCTGATTCTACGCGATATCCAGCATCATTCTGGAAGCACTCTGTCTGATCTAGGAGTACCACATCCAAACACCCAGAAACCATCCAAAGTGTTATTTCTTGGGGCTAGGTATTGGTTTCAACAAAACAATATAGATCAGGTCTTGACCTTCAAACATTTACCCAAAGACGAAGCCTGGCTTTTGTTCTGTGAAAAAACTGGCTCACAGTTTGATTCTCCAGGTATGCATGAACTTGCTGAAACTTTACTCGAATCATGTGGAGGTCTTCCACTTAAAATTGTTACACTAGCAGGAGCTTTGAGGAATGTCAAGGGACCAACTAGTGCGAGATTGATGGAAAATGTACAAAAAGCTTATAAACTAATTATCAGTCGCTCTATGTATCATTATGAGGCTATGTTTAATATGTTGCCGAGCAAGGAAGTGAAAGATTGCATTGTGTACTGCAGCAGCTATCATCTATACTATCATATCAGTGTGAAAGGATTGATTACATCTTGGATAGCTGAAGGACTTCTAGATGAATGTAACTGTTTAGAGGCAGCGCATGAGAAGGCTCAGAAAATAATAAAGGATCTCATTGATCGGCACCTTCTCATTAGATATGATGATAGGCACGTGATAATGAATTACGATGTACGCCTCTGTTTTTCATCTATGATCCATATTTTATTGGAAAAGGCTGGTAGAAGTATGAGGCTAACTGTTCCTGAGCTATTTACGGAACATGAGAGCTTCAGAATGATCTCTATGATGAATGAGAGTTTTGAAATCAAGTACCCCAGCTATGCCACAAAATCCTCCAGTAAATCCTCAACTTTGTTGCTGTATGGAAAGGATGGTTGCCTCCCTGGCGAAATTCCAGATGCCTTCTTTGCGAAAACAAACCATCTTCAATTTCTCTCCATTCTCCATGCTGGCATCAGGTATCTTCCATCATCTCTTTCAAACTTGAAAAATGTTTGTGCTCTTGTGGTCAGAGGTTGTATCGCTTTAGACAATGTGGATACCATTAGAGAACTCCACTGCTTGGTGGTTCTCAATCTTTCGGGTGCTAGCTCCTTGATGGAACTCCCAGATGACTTCTTTGAACATATGCAACTTCTTCAATGCCTGGACCTCTCAGAATCCCAGCTAAAACAGCTGCCCTCATCCTTTTCAAACCTTGGAAATATCCAACGTCTCATCCTTAGAGGATGCTCCTACTTGAAAACGCTGCCGCGTCACGTAGGAGATAAACTCATCGTGCTGGATTTATCAGGGGCTACTGCTCTGGGGGAAATCCCAAATGAATTCATTGAAAAACAAAGGTCCCTACAATTACTTGACCTGTCTGGAACTGTTGTTGACCGATTAATATATCCAAATGGCGTACATAGGGATCTAAGGTACCTCTTTTTGAAAGGTTCACGAATTAAGACATTGCCCCATCCAGAGGCATTTGTGAAGCTGCAGGAACTTGATCTATCAGGTGCCAGTGAATTTAAGGAATTTCAATCCATAACCTCATCTTCTAACAGGTCCATAAAAAAAATTGATTTGTCTAAAACTCAGATTGTCAGCCTACCAAATCTTTCTAAATATCCTAACCTCTGTCAACTCTGTTTGAAAAGTTGTGTATACCTAGAGGAACTTCCACATTTAGAACTGAAAAAACTTCAAGTTCTCGATCTTTCTGGTTCTACGAATTTCAGAAGGTTCCAGGATGATTCCTTTGGGAATATGGACCAACTGGAAATAATTGACTTCTCTGGAACAAAGATCACAAAACTACCATCTGTTTCTGAATGCCTTAAACTCCGTCATCTCTTACTGAAAGGTTGTGAATACCTAATGGAGCTACCACCTTTCCAACTTGAAAATCTTGAAATTCTCAATCTTTCTGGAACCCAGGTAGTAAAGTTGCCGAACCTTTCCAAATGTTGCTTTCTCAGTGAACTACTACTAAGAAAATGTACAAAATTGGTGACCATACCACACTTAGAAGCTCTTGAAAGGCTTGAAGTGCTTGATCTCTCAGGGGCTACTTCTTTAAAGAAATTTCAATACAAACCTATTGAGGTTAATTCCTCGACATTTTCGCATTGTATTGATTGCATCCGTAACTTTCAAAAACTTGACCTCACTACATCTCCATTAGAAATCTCACCCTCGTCTCTGCCAGAACTCGAGAACCTACCTCAGCTCTTTCTGAGAGGTTGTTCATGCTCACTGTTGCAGCCCCATCCAGAAATGCCCAGAAATTATGAAGTGCTTGACTTTTCATGCATGCAAATTAGATATTTTTCTGATGGCAGCTCAAAATGGACTGATCTAAGGTTTCTTGGAATGTTGAATCAAAAGCACCTCTGGGACTTTGATTATGGAAACACGGAGGAGGTGAGTAAGCATCTGAAGTTTGATCAACACGAAGCAGATGATGTTGGAATAACTGCCATACGAATAATATCGAGTAACATCAATCAGTTCAATTTCATGAAGAATAATTCTCAAATGTGGGAGAGAGACTTCCAGAAATTCCATTATTGCCTCTGCTCTCCCAAGGAGTGGGAGAAAGAGAAGGATATTTACTTGCATCAGAGAAGAGTTGTCTTCAAAGATATCTACTACCAGGTCAGTCAGATTCCTCATTCAACAGCTCCAGACCATGTTTTTGAGATATGTGGCTTTGAACTCTTCCCTGTAATAATCGATGAGGTCCTCGGTCATGTGAAAATATTATACTTAAAAAAGAATTCTTTCATCACACGACTATCGGATTTGGGTGCTGGAAATGATATGGTAATGAGAGAATTGTGGATAGAGAGATGTGAGAGCATGGAGTGTGCTTTCTATGGAGACGAGATGAAAGAAAATCTGGCATTAGGGAGATTTTTAGAGAATCTTTGGGTCTCAAATCTCTCTAAACTAAGGAGTTTGTTCTTGGGAGAGATGCAGCCCAAGAGCTTTACATGCCTGAAGCATTTATCTATCGATTGTTGCCCAAGCCTCATCACTGTTTTCTCCTCACATCTGGAACTAGTTAGCCTTGAAACTCTTAAGATCAAATTTTGTGATAAAGTGCAGAACATATTTGGTGAATCAGAGTCCGGAGAACAAACACTCCCAAAGTTAAACACATTGACACTTTGGAGGCTATCACAGCTGCAGAATATTTGTCGAGGTGGATTGCCATCTCTAAAAAATGTCAGAGTCAAAGGATGCTCGAAGCTGTTAAAACTTCCAGTCAGTGCAAGCAATGTGAGTTCAGTGATAGACATCAGAGGAGAAGCGATATGGTGGAACAATTTGGTATGGGAAGATAAAAGCATTATGTCCCGGTTGTCCTTTACAGAGTTACGCAGATTCTTATAG


Protein sequences

Name Description Sequence
Aquca_005_00064.2 protein obtained from Pythozome database for gene Aquca_005_00064.2

MPLVLSGTNNTHGSDQAQSIQGNENACEGEVEHGGGHDNRDTQNLLLDNIVDSRIQETWKNKGKQPMERLELSAQNILHEEDEIRIAEQEKYGVEYLVPSAQKNIETLWKCLNNASIRTIGLEGIGGIGKRWTVSHVVERALVANHFDFIIWVNLQSRSRPMLNQIVDQLNLLSTTTENDDGKEVSDLELMEGISKTLAGKSYLLILRDIQHHSGSTLSDLGVPHPNTQKPSKVLFLGARYWFQQNNIDQVLTFKHLPKDEAWLLFCEKTGSQFDSPGMHELAETLLESCGGLPLKIVTLAGALRNVKGPTSARLMENVQKAYKLIISRSMYHYEAMFNMLPSKEVKDCIVYCSSYHLYYHISVKGLITSWIAEGLLDECNCLEAAHEKAQKIIKDLIDRHLLIRYDDRHVIMNYDVRLCFSSMIHILLEKAGRSMRLTVPELFTEHESFRMISMMNESFEIKYPSYATKSSSKSSTLLLYGKDGCLPGEIPDAFFAKTNHLQFLSILHAGIRYLPSSLSNLKNVCALVVRGCIALDNVDTIRELHCLVVLNLSGASSLMELPDDFFEHMQLLQCLDLSESQLKQLPSSFSNLGNIQRLILRGCSYLKTLPRHVGDKLIVLDLSGATALGEIPNEFIEKQRSLQLLDLSGTVVDRLIYPNGVHRDLRYLFLKGSRIKTLPHPEAFVKLQELDLSGASEFKEFQSITSSSNRSIKKIDLSKTQIVSLPNLSKYPNLCQLCLKSCVYLEELPHLELKKLQVLDLSGSTNFRRFQDDSFGNMDQLEIIDFSGTKITKLPSVSECLKLRHLLLKGCEYLMELPPFQLENLEILNLSGTQVVKLPNLSKCCFLSELLLRKCTKLVTIPHLEALERLEVLDLSGATSLKKFQYKPIEVNSSTFSHCIDCIRNFQKLDLTTSPLEISPSSLPELENLPQLFLRGCSCSLLQPHPEMPRNYEVLDFSCMQIRYFSDGSSKWTDLRFLGMLNQKHLWDFDYGNTEEVSKHLKFDQHEADDVGITAIRIISSNINQFNFMKNNSQMWERDFQKFHYCLCSPKEWEKEKDIYLHQRRVVFKDIYYQVSQIPHSTAPDHVFEICGFELFPVIIDEVLGHVKILYLKKNSFITRLSDLGAGNDMVMRELWIERCESMECAFYGDEMKENLALGRFLENLWVSNLSKLRSLFLGEMQPKSFTCLKHLSIDCCPSLITVFSSHLELVSLETLKIKFCDKVQNIFGESESGEQTLPKLNTLTLWRLSQLQNICRGGLPSLKNVRVKGCSKLLKLPVSASNVSSVIDIRGEAIWWNNLVWEDKSIMSRLSFTELRRFL*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
38-1305 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DNRDTQNLLLDNIVDSRIQETWKNKGKQPMERLELSAQNILHEEDEIRIAEQEKYGVEYLVPSAQKNIETLWKCLNNASIRTIGLEGIGGIGKRWTVSHVVERALVANHFDFIIWVNLQSRSRPMLNQIVDQLNLLSTTTENDDGKEVSDLELMEGISKTLAGKSYLLILRDIQHHSGSTLSDLGVPHPNTQKPSKVLFLGARYWFQQNNIDQVLTFKHLPKDEAWLLFCEKTGSQFDSPGMHELAETLLESCGGLPLKIVTLAGALRNVKGPTSARLMENVQKAYKLIISRSMYHYEAMFNMLPSKEVKDCIVYCSSYHLYYHISVKGLITSWIAEGLLDECNCLEAAHEKAQKIIKDLIDRHLLIRYDDRHVIMNYDVRLCFSSMIHILLEKAGRSMRLTVPELFTEHESFRMISMMNESFEIKYPSYATKSSSKSSTLLLYGKDGCLPGEIPDAFFAKTNHLQFLSILHAGIRYLPSSLSNLKNVCALVVRGCIALDNVDTIRELHCLVVLNLSGASSLMELPDDFFEHMQLLQCLDLSESQLKQLPSSFSNLGNIQRLILRGCSYLKTLPRHVGDKLIVLDLSGATALGEIPNEFIEKQRSLQLLDLSGTVVDRLIYPNGVHRDLRYLFLKGSRIKTLPHPEAFVKLQELDLSGASEFKEFQSITSSSNRSIKKIDLSKTQIVSLPNLSKYPNLCQLCLKSCVYLEELPHLELKKLQVLDLSGSTNFRRFQDDSFGNMDQLEIIDFSGTKITKLPSVSECLKLRHLLLKGCEYLMELPPFQLENLEILNLSGTQVVKLPNLSKCCFLSELLLRKCTKLVTIPHLEALERLEVLDLSGATSLKKFQYKPIEVNSSTFSHCIDCIRNFQKLDLTTSPLEISPSSLPELENLPQLFLRGCSCSLLQPHPEMPRNYEVLDFSCMQIRYFSDGSSKWTDLRFLGMLNQKHLWDFDYGNTEEVSKHLKFDQHEADDVGITAIRIISSNINQFNFMKNNSQMWERDFQKFHYCLCSPKEWEKEKDIYLHQRRVVFKDIYYQVSQIPHSTAPDHVFEICGFELFPVIIDEVLGHVKILYLKKNSFITRLSDLGAGNDMVMRELWIERCESMECAFYGDEMKENLALGRFLENLWVSNLSKLRSLFLGEMQPKSFTCLKHLSIDCCPSLITVFSSHLELVSLETLKIKFCDKVQNIFGESESGEQTLPKLNTLTLWRLSQLQNICRGGLPSLKNVRVKGCSKLLKLPVSASNVSSVIDIRGEAIWWNNLVWED

Coil: coil
70-91 coiled-coil

LELSAQNILHEEDEIRIAEQEK

HMMPfam: PF00931
IPR002182
102-377 NB-ARC,NBS
NB-ARC

QKNIETLWKCLNNASIRTIGLEGIGGIGKRWTVSHVVERALVANHFDFIIWVNLQSRSRPMLNQIVDQLNLLSTTTENDDGKEVSDLELMEGISKTLAGKSYLLILRDIQHHSGSTLSDLGVPHPNTQKPSKVLFLGARYWFQQNNIDQVLTFKHLPKDEAWLLFCEKTGSQFDSPGMHELAETLLESCGGLPLKIVTLAGALRNVKGPTSARLMENVQKAYKLIISRSMYHYEAMFNMLPSKEVKDCIVYCSSYHLYYHISVKGLITSWIAEGLL

superfamily: SSF52540
105-306 P-loop containing nucleoside triphosphate hydrolases

IETLWKCLNNASIRTIGLEGIGGIGKRWTVSHVVERALVANHFDFIIWVNLQSRSRPMLNQIVDQLNLLSTTTENDDGKEVSDLELMEGISKTLAGKSYLLILRDIQHHSGSTLSDLGVPHPNTQKPSKVLFLGARYWFQQNNIDQVLTFKHLPKDEAWLLFCEKTGSQFDSPGMHELAETLLESCGGLPLKIVTLAGALRN

FPrintScan: PR00364
IPR000767
119-134 DISEASERSIST
Disease resistance protein

TIGLEGIGGIGKRWTV

FPrintScan: PR00364
IPR000767
197-211 DISEASERSIST
Disease resistance protein

TLAGKSYLLILRDIQ

FPrintScan: PR00364
IPR000767
290-304 DISEASERSIST
Disease resistance protein

CGGLPLKIVTLAGAL

Coil: coil
373-401 coiled-coil

AEGLLDECNCLEAAHEKAQKIIKDLIDRH

superfamily: SSF52058
451-750 L domain-like,LRR

RMISMMNESFEIKYPSYATKSSSKSSTLLLYGKDGCLPGEIPDAFFAKTNHLQFLSILHAGIRYLPSSLSNLKNVCALVVRGCIALDNVDTIRELHCLVVLNLSGASSLMELPDDFFEHMQLLQCLDLSESQLKQLPSSFSNLGNIQRLILRGCSYLKTLPRHVGDKLIVLDLSGATALGEIPNEFIEKQRSLQLLDLSGTVVDRLIYPNGVHRDLRYLFLKGSRIKTLPHPEAFVKLQELDLSGASEFKEFQSITSSSNRSIKKIDLSKTQIVSLPNLSKYPNLCQLCLKSCVYLEELP

Seg: seg
469-480 seg

TKSSSKSSTLLL

Gene3D: G3DSA:3.80.10.10
491-680 no description

IPDAFFAKTNHLQFLSILHAGIRYLPSSLSNLKNVCALVVRGCIALDNVDTIRELHCLVVLNLSGASSLMELPDDFFEHMQLLQCLDLSESQLKQLPSSFSNLGNIQRLILRGCSYLKTLPRHVGDKLIVLDLSGATALGEIPNEFIEKQRSLQLLDLSGTVVDRLIYPNGVHRDLRYLFLKGSRIKTLP

HMMSmart: SM00369
IPR003591
545-569 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LHCLVVLNLSGASSLMELPDDFFEH

HMMPfam: PF13855
549-604 LRR_8,Leucine rich repeat

VVLNLSGASSLMELPDDFFEHMQLLQCLDLSESQLKQLPSSFSNLGNIQRLILRGC

HMMSmart: SM00369
IPR003591
570-592 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MQLLQCLDLSESQLKQLPSSFSN

ProfileScan: PS51450
IPR001611
572-593 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLQCLDLSESQLKQLPSSFSNL

ProfileScan: PS51450
IPR001611
665-686 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLRYLFLKGSRIKTLPHPEAFV

Gene3D: G3DSA:3.80.10.10
681-878 no description

HPEAFVKLQELDLSGASEFKEFQSITSSSNRSIKKIDLSKTQIVSLPNLSKYPNLCQLCLKSCVYLEELPHLELKKLQVLDLSGSTNFRRFQDDSFGNMDQLEIIDFSGTKITKLPSVSECLKLRHLLLKGCEYLMELPPFQLENLEILNLSGTQVVKLPNLSKCCFLSELLLRKCTKLVTIPHLEALERLEVLDLSG

ProfileScan: PS51450
IPR001611
712-733 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIKKIDLSKTQIVSLPNLSKYP

Seg: seg
746-757 seg

LEELPHLELKKL

FPrintScan: PR00364
IPR000767
752-768 DISEASERSIST
Disease resistance protein

LELKKLQVLDLSGSTNF

HMMSmart: SM00369
IPR003591
754-778 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKKLQVLDLSGSTNFRRFQDDSFGN

superfamily: SSF52058
755-1273 L domain-like,LRR

KKLQVLDLSGSTNFRRFQDDSFGNMDQLEIIDFSGTKITKLPSVSECLKLRHLLLKGCEYLMELPPFQLENLEILNLSGTQVVKLPNLSKCCFLSELLLRKCTKLVTIPHLEALERLEVLDLSGATSLKKFQYKPIEVNSSTFSHCIDCIRNFQKLDLTTSPLEISPSSLPELENLPQLFLRGCSCSLLQPHPEMPRNYEVLDFSCMQIRYFSDGSSKWTDLRFLGMLNQKHLWDFDYGNTEEVSKHLKFDQHEADDVGITAIRIISSNINQFNFMKNNSQMWERDFQKFHYCLCSPKEWEKEKDIYLHQRRVVFKDIYYQVSQIPHSTAPDHVFEICGFELFPVIIDEVLGHVKILYLKKNSFITRLSDLGAGNDMVMRELWIERCESMECAFYGDEMKENLALGRFLENLWVSNLSKLRSLFLGEMQPKSFTCLKHLSIDCCPSLITVFSSHLELVSLETLKIKFCDKVQNIFGESESGEQTLPKLNTLTLWRLSQLQNICRGGLPSLKNVRVKGCS

HMMPfam: PF13855
756-812 LRR_8,Leucine rich repeat

KLQVLDLSGSTNFRRFQDDSFGNMDQLEIIDFSGTKITKLPSVSECLKLRHLLLKGC

HMMSmart: SM00369
IPR003591
779-802 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MDQLEIIDFSGTKITKLPSVSECL

ProfileScan: PS51450
IPR001611
781-802 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLEIIDFSGTKITKLPSVSECL

HMMSmart: SM00369
IPR003591
823-845 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LENLEILNLSGTQVVKLPNLSKC

HMMPfam: PF00560
IPR001611
825-845 LRR_1
Leucine-rich repeat

NLEILNLSGTQVVKLPNLSKC

ProfileScan: PS51450
IPR001611
825-846 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEILNLSGTQVVKLPNLSKCC

Seg: seg
915-931 seg

SPLEISPSSLPELENLP

Gene3D: G3DSA:3.80.10.10
1169-1286 no description

SNLSKLRSLFLGEMQPKSFTCLKHLSIDCCPSLITVFSSHLELVSLETLKIKFCDKVQNIFGESESGEQTLPKLNTLTLWRLSQLQNICRGGLPSLKNVRVKGCSKLLKLPVSASNVS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox