PRGDB00206986 (Aquca_005_00563.1)

From PRG Wiki
Jump to: navigation, search
Aquca_005_00563.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia coerulea

Comment?

DNA Sequence

ATGCGGATGACATTTGCACTGCCGTATCCTTGCAATTCAACTTTGGGACAGTATATTCTGCCACAGACAGCTTCAGTGATGCTAATAAGGTTGCAGTATACAAGGTTGCAGTCTGCTGCTAAACTTGTTAGACTTTTAGGTTTCTGCCTGGAAGGAGATGAAAAGCTTTGCCTCTACGAATTTGTGCCGAATGCAAGCCTTGACCAGTTTATATTTGATCCAGTCAAACGCACATATTTGGATTGGGAGAGACGGTATAAAATCATAGTAGGAATTGCTAGGGGACTTCTCTATCTTCATGAGGATTCTCCAGACACGATTGTCCATCGAGATCTAAAACCTAGGAGTATTTTGTTAGATGCACAAATGAATCCCAAAATTTCTAACTTTGGCATGGCCAGGCTTTTTGTGTTAGACCAAACTCAGGGCAGTACCAGTAAAATTGTTGGAACATATGGGTACATGGCTCCCGAATATGCAATGCATGGGCATTTCTCAGTGAAATCAGATGTCTTCAGCTTTGGTGTCTTAGCCTGGGGACAATGGGAGGAAGAGACTGTTTTAGAGATAATAGAGCCAACTTTAAGGGAATGTTATTCAAGAAGCGAATTCAGGAGATGTATACAAATCGGGTTGTTGTGTGTTCACGAAGATGCAGCAAGGAGACCTACAATGTCATCTGTTGCTTTAATGCTCAGCAGCCACTCTTTCACCCTTCCAGTACCATCTGCACATGCATTTTTTGACAATACAGAAATGGGACTGAATAGGATCTTAAGAGGACAATGGTACAAATTCAGCGAGGGGATCAGTTGTCCCAAACCATTCTATAGGTAG


Protein sequences

Name Description Sequence
Aquca_005_00563.1 protein obtained from Pythozome database for gene Aquca_005_00563.1

MRMTFALPYPCNSTLGQYILPQTASVMLIRLQYTRLQSAAKLVRLLGFCLEGDEKLCLYEFVPNASLDQFIFDPVKRTYLDWERRYKIIVGIARGLLYLHEDSPDTIVHRDLKPRSILLDAQMNPKISNFGMARLFVLDQTQGSTSKIVGTYGYMAPEYAMHGHFSVKSDVFSFGVLAWGQWEEETVLEIIEPTLRECYSRSEFRRCIQIGLLCVHEDAARRPTMSSVALMLSSHSFTLPVPSAHAFFDNTEMGLNRILRGQWYKFSEGISCPKPFYR*

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-238 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MRMTFALPYPCNSTLGQYILPQTASVMLIRLQYTRLQSAAKLVRLLGFCLEGDEKLCLYEFVPNASLDQFIFDPVKRTYLDWERRYKIIVGIARGLLYLHEDSPDTIVHRDLKPRSILLDAQMNPKISNFGMARLFVLDQTQGSTSKIVGTYGYMAPEYAMHGHFSVKSDVFSFGVLAWGQWEEETVLEIIEPTLRECYSRSEFRRCIQIGLLCVHEDAARRPTMSSVALMLSSHSFT

HMMSmart: SM00220
IPR002290
9-238 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YPCNSTLGQYILPQTASVMLIRLQYTRLQSAAKLVRLLGFCLEGDEKLCLYEFVPNASLDQFIFDPVKRTYLDWERRYKIIVGIARGLLYLHEDSPDTIVHRDLKPRSILLDAQMNPKISNFGMARLFVLDQTQGSTSKIVGTYGYMAPEYAMHGHFSVKSDVFSFGVLAWGQWEEETVLEIIEPTLRECYSRSEFRRCIQIGLLCVHEDAARRPTMSSVALMLSSHSFT

HMMSmart: SM00219
IPR020635
13-232 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

STLGQYILPQTASVMLIRLQYTRLQSAAKLVRLLGFCLEGDEKLCLYEFVPNASLDQFIFDPVKRTYLDWERRYKIIVGIARGLLYLHEDSPDTIVHRDLKPRSILLDAQMNPKISNFGMARLFVLDQTQGSTSKIVGTYGYMAPEYAMHGHFSVKSDVFSFGVLAWGQWEEETVLEIIEPTLRECYSRSEFRRCIQIGLLCVHEDAARRPTMSSVALML

HMMPfam: PF07714
IPR001245
38-229 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SAAKLVRLLGFCLEGDEKLCLYEFVPNASLDQFIFDPVKRTYLDWERRYKIIVGIARGLLYLHEDSPDTIVHRDLKPRSILLDAQMNPKISNFGMARLFVLDQTQGSTSKIVGTYGYMAPEYAMHGHFSVKSDVFSFGVLAWGQWEEETVLEIIEPTLRECYSRSEFRRCIQIGLLCVHEDAARRPTMSSVA

HMMPanther: PTHR24420
42-252 FAMILY NOT NAMED,FAMILY NOT NAMED

LVRLLGFCLEGDEKLCLYEFVPNASLDQFIFDPVKRTYLDWERRYKIIVGIARGLLYLHEDSPDTIVHRDLKPRSILLDAQMNPKISNFGMARLFVLDQTQGSTSKIVGTYGYMAPEYAMHGHFSVKSDVFSFGVLAWGQWEEETVLEIIEPTLRECYSRSEFRRCIQIGLLCVHEDAARRPTMSSVALMLSSHSFTLPVPSAHAFFDNTE

superfamily: SSF56112
IPR011009
42-248 Protein kinase-like (PK-like)
Protein kinase-like domain

LVRLLGFCLEGDEKLCLYEFVPNASLDQFIFDPVKRTYLDWERRYKIIVGIARGLLYLHEDSPDTIVHRDLKPRSILLDAQMNPKISNFGMARLFVLDQTQGSTSKIVGTYGYMAPEYAMHGHFSVKSDVFSFGVLAWGQWEEETVLEIIEPTLRECYSRSEFRRCIQIGLLCVHEDAARRPTMSSVALMLSSHSFTLPVPSAHAFF

HMMPanther: PTHR24420:SF430
42-252 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LVRLLGFCLEGDEKLCLYEFVPNASLDQFIFDPVKRTYLDWERRYKIIVGIARGLLYLHEDSPDTIVHRDLKPRSILLDAQMNPKISNFGMARLFVLDQTQGSTSKIVGTYGYMAPEYAMHGHFSVKSDVFSFGVLAWGQWEEETVLEIIEPTLRECYSRSEFRRCIQIGLLCVHEDAARRPTMSSVALMLSSHSFTLPVPSAHAFFDNTE

Gene3D: G3DSA:1.10.510.10
62-230 no description

VPNASLDQFIFDPVKRTYLDWERRYKIIVGIARGLLYLHEDSPDTIVHRDLKPRSILLDAQMNPKISNFGMARLFVLDQTQGSTSKIVGTYGYMAPEYAMHGHFSVKSDVFSFGVLAWGQWEEETVLEIIEPTLRECYSRSEFRRCIQIGLLCVHEDAARRPTMSSVAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox