PRGDB00206990 (Aquca_005_00535.1)

From PRG Wiki
Jump to: navigation, search
Aquca_005_00535.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia coerulea

Comment?

DNA Sequence

ATGGTTTTGGTGAGAGAAAGAAGGAATCAGCAACCACTCAGACTTCCCTTACCCCTTCAAGAACCTTCATTAGACTTCCATCAATGGAACACATACCCTTTACCCATGGTGTCCACTGGACCAGACTCCCCAACCATAGAGAGCCTTTTCGACTTGGAGAAGTTGGGAGTTGTAGGCCATGGCAATGGTGGTATTGTCTATAAAGTCCAACACCTTAGAAATTCATCAGTCTATGCTCTCAAAGTTCTTCGGTTTGAGAATGAAAATTTTCATCTTAGGAAAAAGGCAGTTGGTGAGGCCGAGATACTCAAACAGGTTGATTCGGAATTCATTGTTAGGTGTCATGGGGTGTTTGATAGTGGTGGAGATACAGAAAATGGAGACTTGTGCTTCTTGATGGAGTACATGGAAGGTGGATCATTAAACGATGTATTGCGAGTTCATGGAAGTCTCCCAGAGAATGTTATTTCTGGTGTGGCGAAGCGAGTCTTGGAAGGGCTTAGTTACCTTCATGGTTTGCACATTGTGCATAGAGACATTAAGCCATCAAATTTGCTAATTAATGGTCAAGGGGAGGTAAAAATTGCAGACTTTGGGGTTAGCAGGGTGTTAGCAGGTACATTCGATGCAAGTGAATTCTGTGAGGGAACATGTGCTTACATGAGTCCTGAGAGGTTTGATTCTGACAAGTGGACTGAAAGTTGGTGCAACGGATTTGCAGGAGATGTCTGGGCACTTGGGTTGGCCTTGCTGGAATGTTATATGGGTCACTTTCCTCTGTTAGCTCCTGGGAAAAAGCCAGATTGGGTAACATTAATGTGTGCCATATGTTTTATTGAGCGACCAGAGATTCCCAGTACAGCATCATCAGAGTTCAAGAGCTTCATTTATCGATGTCTAGAGAAAGATTGGAGAAGAAGAGGAACTGTAACAGAACTTCTTCGCCACCCTTTTGTTGCTAAGCAAAATACAGGATTGGTTGATTCTTTCTAG


Protein sequences

Name Description Sequence
Aquca_005_00535.1 protein obtained from Pythozome database for gene Aquca_005_00535.1

MVLVRERRNQQPLRLPLPLQEPSLDFHQWNTYPLPMVSTGPDSPTIESLFDLEKLGVVGHGNGGIVYKVQHLRNSSVYALKVLRFENENFHLRKKAVGEAEILKQVDSEFIVRCHGVFDSGGDTENGDLCFLMEYMEGGSLNDVLRVHGSLPENVISGVAKRVLEGLSYLHGLHIVHRDIKPSNLLINGQGEVKIADFGVSRVLAGTFDASEFCEGTCAYMSPERFDSDKWTESWCNGFAGDVWALGLALLECYMGHFPLLAPGKKPDWVTLMCAICFIERPEIPSTASSEFKSFIYRCLEKDWRRRGTVTELLRHPFVAKQNTGLVDSF*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24361
4-321 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

VRERRNQQPLRLPLPLQEPSLDFHQWNTYPLPMVSTGPDSPTIESLFDLEKLGVVGHGNGGIVYKVQHLRNSSVYALKVLRFENENFHLRKKAVGEAEILKQVDSEFIVRCHGVFDSGGDTENGDLCFLMEYMEGGSLNDVLRVHGSLPENVISGVAKRVLEGLSYLHGLHIVHRDIKPSNLLINGQGEVKIADFGVSRVLAGTFDASEFCEGTCAYMSPERFDSDKWTESWCNGFAGDVWALGLALLECYMGHFPLLAPGKKPDWVTLMCAICFIERPEIPSTASSEFKSFIYRCLEKDWRRRGTVTELLRHPFVAK

HMMPanther: PTHR24361:SF31
4-321 SUBFAMILY NOT NAMED

VRERRNQQPLRLPLPLQEPSLDFHQWNTYPLPMVSTGPDSPTIESLFDLEKLGVVGHGNGGIVYKVQHLRNSSVYALKVLRFENENFHLRKKAVGEAEILKQVDSEFIVRCHGVFDSGGDTENGDLCFLMEYMEGGSLNDVLRVHGSLPENVISGVAKRVLEGLSYLHGLHIVHRDIKPSNLLINGQGEVKIADFGVSRVLAGTFDASEFCEGTCAYMSPERFDSDKWTESWCNGFAGDVWALGLALLECYMGHFPLLAPGKKPDWVTLMCAICFIERPEIPSTASSEFKSFIYRCLEKDWRRRGTVTELLRHPFVAK

Seg: seg
5-22 seg

RERRNQQPLRLPLPLQEP

superfamily: SSF56112
IPR011009
38-321 Protein kinase-like (PK-like)
Protein kinase-like domain

STGPDSPTIESLFDLEKLGVVGHGNGGIVYKVQHLRNSSVYALKVLRFENENFHLRKKAVGEAEILKQVDSEFIVRCHGVFDSGGDTENGDLCFLMEYMEGGSLNDVLRVHGSLPENVISGVAKRVLEGLSYLHGLHIVHRDIKPSNLLINGQGEVKIADFGVSRVLAGTFDASEFCEGTCAYMSPERFDSDKWTESWCNGFAGDVWALGLALLECYMGHFPLLAPGKKPDWVTLMCAICFIERPEIPSTASSEFKSFIYRCLEKDWRRRGTVTELLRHPFVAK

HMMSmart: SM00219
IPR020635
52-319 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LEKLGVVGHGNGGIVYKVQHLRNSSVYALKVLRFENENFHLRKKAVGEAEILKQVDSEFIVRCHGVFDSGGDTENGDLCFLMEYMEGGSLNDVLRVHGSLPENVISGVAKRVLEGLSYLHGLHIVHRDIKPSNLLINGQGEVKIADFGVSRVLAGTFDASEFCEGTCAYMSPERFDSDKWTESWCNGFAGDVWALGLALLECYMGHFPLLAPGKKPDWVTLMCAICFIERPEIPSTASSEFKSFIYRCLEKDWRRRGTVTELLRHPFV

Gene3D: G3DSA:3.30.200.20
52-152 no description

LEKLGVVGHGNGGIVYKVQHLRNSSVYALKVLRFENENFHLRKKAVGEAEILKQVDSEFIVRCHGVFDSGGDTENGDLCFLMEYMEGGSLNDVLRVHGSLP

ProfileScan: PS50011
IPR000719
52-319 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LEKLGVVGHGNGGIVYKVQHLRNSSVYALKVLRFENENFHLRKKAVGEAEILKQVDSEFIVRCHGVFDSGGDTENGDLCFLMEYMEGGSLNDVLRVHGSLPENVISGVAKRVLEGLSYLHGLHIVHRDIKPSNLLINGQGEVKIADFGVSRVLAGTFDASEFCEGTCAYMSPERFDSDKWTESWCNGFAGDVWALGLALLECYMGHFPLLAPGKKPDWVTLMCAICFIERPEIPSTASSEFKSFIYRCLEKDWRRRGTVTELLRHPFV

HMMSmart: SM00220
IPR002290
52-319 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LEKLGVVGHGNGGIVYKVQHLRNSSVYALKVLRFENENFHLRKKAVGEAEILKQVDSEFIVRCHGVFDSGGDTENGDLCFLMEYMEGGSLNDVLRVHGSLPENVISGVAKRVLEGLSYLHGLHIVHRDIKPSNLLINGQGEVKIADFGVSRVLAGTFDASEFCEGTCAYMSPERFDSDKWTESWCNGFAGDVWALGLALLECYMGHFPLLAPGKKPDWVTLMCAICFIERPEIPSTASSEFKSFIYRCLEKDWRRRGTVTELLRHPFV

HMMPfam: PF00069
IPR000719
53-319 Pkinase,Ser-thr
Protein kinase, catalytic domain

EKLGVVGHGNGGIVYKVQHLRNSSVYALKVLRFENENFHLRKKAVGEAEILKQVDSEFIVRCHGVFDSGGDTENGDLCFLMEYMEGGSLNDVLRVHGSLPENVISGVAKRVLEGLSYLHGLHIVHRDIKPSNLLINGQGEVKIADFGVSRVLAGTFDASEFCEGTCAYMSPERFDSDKWTESWCNGFAGDVWALGLALLECYMGHFPLLAPGKKPDWVTLMCAICFIERPEIPSTASSEFKSFIYRCLEKDWRRRGTVTELLRHPFV

PatternScan: PS00107
IPR017441
58-81 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGHGNGGIVYKVQHLRNSSVYALK

Gene3D: G3DSA:1.10.510.10
153-322 no description

ENVISGVAKRVLEGLSYLHGLHIVHRDIKPSNLLINGQGEVKIADFGVSRVLAGTFDASEFCEGTCAYMSPERFDSDKWTESWCNGFAGDVWALGLALLECYMGHFPLLAPGKKPDWVTLMCAICFIERPEIPSTASSEFKSFIYRCLEKDWRRRGTVTELLRHPFVAKQ

PatternScan: PS00108
IPR008271
175-187 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKPSNLLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox