PRGDB00206991 (Aquca_005_00428.1)

From PRG Wiki
Jump to: navigation, search
Aquca_005_00428.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLK-GNK2
Domain Type Ser-Thr Kinase, GNK2
Gene Species Aquilegia coerulea

Comment?

DNA Sequence

ATGTCTGAAGCTAATCTCAACCTCCTCCTTTCTTCTCTATCTAATAATAACACTAGATTTGCCACCAACGCTGTGGGAACAGGTCCAGATAGATTTTATGGGCTATTTCAATGCATAGGTATAAGTAAATATATATCTGACGAAAAGTGCAACAAATGTGCAAAAAGAGCTACTGCTCAGATCACAACCAAGTGCCCTTACAAAGCAGGAGCTAATATTTACTATGATGAGTGTTGGTTGCATTACTCAAATGACTCCTTCCTAGGGATTCTACAGGATGGACCAACTCTTTCTAATGGAGATTTTATGTTAGACCCAACTTGGCCTACTAATGAAGTTATCAAATTCATGGATGGTCTAGCACTTCAAGCACTATCTGTTCCAAATTGGTTTGCATATGATCAACAAACTCTTCCACCACCATTTAAGAGTATATATGGTTTTGTTCAATGCACGCAAGTTCTAAACAGAACTTCTTGTGGTAATTGCCTTAAACTAGCTATTTCCGAGATTAATAATTGTTGTAGTCAGAAGCGAAGGGCAAGTATTTTGAAACCAAGTTGTATATTACGGTATGATCAAATTGATATCCTTGGAAATGGTGAAGGGGAAATACCATCTAGCCCAAATATCATCAAGGACCAGAAGAGTTCATCCAGAACAATCATTATTATAGTAGTTCCAACTGCGATCGGAGTTGTATTTCTATCATCTGTCGCAATATGTTTATATTTACGAAGAAAGAAGGAATTCAAGATAACCAGAGATGACCATGAGATCAACACTGTGGAATCTTTACAATTCAACATTGGGACAGTGAGAGCTGCTACAGATAACTTCTGTGATGCTAATAAGCTTGGAGAAGGTGGCTTTGGGTCTGTTTACAAGGGCGTTCTTTCTGATGGCCAAGAGATCGCTGTAAAAAGGCTCTCAAGAAACTCTGGCCAAGGTGTAATCGAATTTAAGAATGAGGTTCTATTAGTAGCCAAACTTCAACATCGAAATCTTGCAAGGCTTTTAGGTTTCTGCTTGGAAGGAGATGAAACGATTCTCATTTACGAGTACCTGCCCAACACAAGTCTCGATCACTTTATATTTGATCCAATCAAGCGCACTTATCTGGATTGGGAAAGACGTTACAAGATCATAGGGGGAATTGCTAGAGGTCTTCTCTACCTACATGAGGATTCTCGTCATAGAATTATTCATCGAGATCTCAAAGCTAGCAATGTTTTGTTAGATGCAGAAATGAATCCGAAAATTGCAGATTTTGGCATGGCAAGGCTTTTTGTGGTGGACCAAACTCAGGGGAGTACCAGTAGAATAGTTGGTACATTTGGATACATGTCTCCAGAGTATGCAAGGCATGGACGCTTTTCTGTGAAATCAGATGTCTTTAGTTTTGGTGTATTAGTTTTAGAGATAATAACTGGTCAGAAGAACACCGGTTTCTATAAATCAGAACGTACTCAGGACCTTATAAGCCAGGTATGGAGACATTGGGAGGAAGGAAAAGCTTTAGAGTTGATTGAACCATCACTAGAGGACCGTTATTCAAGAACAGAGGTTATGCGATGCATACACATTGGACTGTTATGTGTTCAAGAAGACATGAGAATGAGACCCACAATGGCCTCAGTTGTTCTCATGCTCAACAGCAATTTTGCAACTATGCCATTACCTTCAACACCTGGATTCTTTGTTAGTACCTTTAGAAAAGAATCATACCAGAGCACAGGGGTGAATGAAGTACACACAAATTACACAACCCAGTCGGTGGTGCCAGCTCCATCTATGACGTCCATTGCTGAAGCATCAATTACTGAGTTAAGCCCTCGATGA


Protein sequences

Name Description Sequence
Aquca_005_00428.1 protein obtained from Pythozome database for gene Aquca_005_00428.1

MSEANLNLLLSSLSNNNTRFATNAVGTGPDRFYGLFQCIGISKYISDEKCNKCAKRATAQITTKCPYKAGANIYYDECWLHYSNDSFLGILQDGPTLSNGDFMLDPTWPTNEVIKFMDGLALQALSVPNWFAYDQQTLPPPFKSIYGFVQCTQVLNRTSCGNCLKLAISEINNCCSQKRRASILKPSCILRYDQIDILGNGEGEIPSSPNIIKDQKSSSRTIIIIVVPTAIGVVFLSSVAICLYLRRKKEFKITRDDHEINTVESLQFNIGTVRAATDNFCDANKLGEGGFGSVYKGVLSDGQEIAVKRLSRNSGQGVIEFKNEVLLVAKLQHRNLARLLGFCLEGDETILIYEYLPNTSLDHFIFDPIKRTYLDWERRYKIIGGIARGLLYLHEDSRHRIIHRDLKASNVLLDAEMNPKIADFGMARLFVVDQTQGSTSRIVGTFGYMSPEYARHGRFSVKSDVFSFGVLVLEIITGQKNTGFYKSERTQDLISQVWRHWEEGKALELIEPSLEDRYSRTEVMRCIHIGLLCVQEDMRMRPTMASVVLMLNSNFATMPLPSTPGFFVSTFRKESYQSTGVNEVHTNYTTQSVVPAPSMTSIAEASITELSPR*

Domains

Domain Start-End Description Sequence

ProfileScan: PS51473
IPR002902
1-87 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

MSEANLNLLLSSLSNNNTRFATNAVGTGPDRFYGLFQCIGISKYISDEKCNKCAKRATAQITTKCPYKAGANIYYDECWLHYSNDSF

HMMPfam: PF01657
IPR002902
3-87 Stress-antifung
Gnk2-homologous domain

EANLNLLLSSLSNNNTRFATNAVGTGPDRFYGLFQCIGISKYISDEKCNKCAKRATAQITTKCPYKAGANIYYDECWLHYSNDSF

Seg: seg
5-17 seg

NLNLLLSSLSNNN

ProfileScan: PS51473
IPR002902
91-197 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

LQDGPTLSNGDFMLDPTWPTNEVIKFMDGLALQALSVPNWFAYDQQTLPPPFKSIYGFVQCTQVLNRTSCGNCLKLAISEINNCCSQKRRASILKPSCILRYDQIDI

HMMPfam: PF01657
IPR002902
116-193 Stress-antifung
Gnk2-homologous domain

FMDGLALQALSVPNWFAYDQQTLPPPFKSIYGFVQCTQVLNRTSCGNCLKLAISEINNCCSQKRRASILKPSCILRYD

HMMPanther: PTHR24420
143-610 FAMILY NOT NAMED,FAMILY NOT NAMED

KSIYGFVQCTQVLNRTSCGNCLKLAISEINNCCSQKRRASILKPSCILRYDQIDILGNGEGEIPSSPNIIKDQKSSSRTIIIIVVPTAIGVVFLSSVAICLYLRRKKEFKITRDDHEINTVESLQFNIGTVRAATDNFCDANKLGEGGFGSVYKGVLSDGQEIAVKRLSRNSGQGVIEFKNEVLLVAKLQHRNLARLLGFCLEGDETILIYEYLPNTSLDHFIFDPIKRTYLDWERRYKIIGGIARGLLYLHEDSRHRIIHRDLKASNVLLDAEMNPKIADFGMARLFVVDQTQGSTSRIVGTFGYMSPEYARHGRFSVKSDVFSFGVLVLEIITGQKNTGFYKSERTQDLISQVWRHWEEGKALELIEPSLEDRYSRTEVMRCIHIGLLCVQEDMRMRPTMASVVLMLNSNFATMPLPSTPGFFVSTFRKESYQSTGVNEVHTNYTTQSVVPAPSMTSIAEASITEL

HMMPanther: PTHR24420:SF430
143-610 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

KSIYGFVQCTQVLNRTSCGNCLKLAISEINNCCSQKRRASILKPSCILRYDQIDILGNGEGEIPSSPNIIKDQKSSSRTIIIIVVPTAIGVVFLSSVAICLYLRRKKEFKITRDDHEINTVESLQFNIGTVRAATDNFCDANKLGEGGFGSVYKGVLSDGQEIAVKRLSRNSGQGVIEFKNEVLLVAKLQHRNLARLLGFCLEGDETILIYEYLPNTSLDHFIFDPIKRTYLDWERRYKIIGGIARGLLYLHEDSRHRIIHRDLKASNVLLDAEMNPKIADFGMARLFVVDQTQGSTSRIVGTFGYMSPEYARHGRFSVKSDVFSFGVLVLEIITGQKNTGFYKSERTQDLISQVWRHWEEGKALELIEPSLEDRYSRTEVMRCIHIGLLCVQEDMRMRPTMASVVLMLNSNFATMPLPSTPGFFVSTFRKESYQSTGVNEVHTNYTTQSVVPAPSMTSIAEASITEL

superfamily: SSF56112
IPR011009
266-582 Protein kinase-like (PK-like)
Protein kinase-like domain

LQFNIGTVRAATDNFCDANKLGEGGFGSVYKGVLSDGQEIAVKRLSRNSGQGVIEFKNEVLLVAKLQHRNLARLLGFCLEGDETILIYEYLPNTSLDHFIFDPIKRTYLDWERRYKIIGGIARGLLYLHEDSRHRIIHRDLKASNVLLDAEMNPKIADFGMARLFVVDQTQGSTSRIVGTFGYMSPEYARHGRFSVKSDVFSFGVLVLEIITGQKNTGFYKSERTQDLISQVWRHWEEGKALELIEPSLEDRYSRTEVMRCIHIGLLCVQEDMRMRPTMASVVLMLNSNFATMPLPSTPGFFVSTFRKESYQSTGVN

Gene3D: G3DSA:3.30.200.20
267-355 no description

QFNIGTVRAATDNFCDANKLGEGGFGSVYKGVLSDGQEIAVKRLSRNSGQGVIEFKNEVLLVAKLQHRNLARLLGFCLEGDETILIYEY

HMMSmart: SM00220
IPR002290
280-527 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FCDANKLGEGGFGSVYKGVLSDGQEIAVKRLSRNSGQGVIEFKNEVLLVAKLQHRNLARLLGFCLEGDETILIYEYLPNTSLDHFIFDPIKRTYLDWERRYKIIGGIARGLLYLHEDSRHRIIHRDLKASNVLLDAEMNPKIADFGMARLFVVDQTQGSTSRIVGTFGYMSPEYARHGRFSVKSDVFSFGVLVLEIITGQKNTGFYKSERTQDLISQVWRHWEEGKALELIEPSLEDRYSRTEVMRCI

ProfileScan: PS50011
IPR000719
280-555 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FCDANKLGEGGFGSVYKGVLSDGQEIAVKRLSRNSGQGVIEFKNEVLLVAKLQHRNLARLLGFCLEGDETILIYEYLPNTSLDHFIFDPIKRTYLDWERRYKIIGGIARGLLYLHEDSRHRIIHRDLKASNVLLDAEMNPKIADFGMARLFVVDQTQGSTSRIVGTFGYMSPEYARHGRFSVKSDVFSFGVLVLEIITGQKNTGFYKSERTQDLISQVWRHWEEGKALELIEPSLEDRYSRTEVMRCIHIGLLCVQEDMRMRPTMASVVLMLNSNF

HMMSmart: SM00219
IPR020635
280-551 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FCDANKLGEGGFGSVYKGVLSDGQEIAVKRLSRNSGQGVIEFKNEVLLVAKLQHRNLARLLGFCLEGDETILIYEYLPNTSLDHFIFDPIKRTYLDWERRYKIIGGIARGLLYLHEDSRHRIIHRDLKASNVLLDAEMNPKIADFGMARLFVVDQTQGSTSRIVGTFGYMSPEYARHGRFSVKSDVFSFGVLVLEIITGQKNTGFYKSERTQDLISQVWRHWEEGKALELIEPSLEDRYSRTEVMRCIHIGLLCVQEDMRMRPTMASVVLML

HMMPfam: PF07714
IPR001245
284-549 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

NKLGEGGFGSVYKGVLSDGQEIAVKRLSRNSGQGVIEFKNEVLLVAKLQHRNLARLLGFCLEGDETILIYEYLPNTSLDHFIFDPIKRTYLDWERRYKIIGGIARGLLYLHEDSRHRIIHRDLKASNVLLDAEMNPKIADFGMARLFVVDQTQGSTSRIVGTFGYMSPEYARHGRFSVKSDVFSFGVLVLEIITGQKNTGFYKSERTQDLISQVWRHWEEGKALELIEPSLEDRYSRTEVMRCIHIGLLCVQEDMRMRPTMASVVL

PatternScan: PS00107
IPR017441
286-308 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGSVYKGVLSDGQEIAVK

Gene3D: G3DSA:1.10.510.10
360-549 no description

SLDHFIFDPIKRTYLDWERRYKIIGGIARGLLYLHEDSRHRIIHRDLKASNVLLDAEMNPKIADFGMARLFVVDQTQGSTSRIVGTFGYMSPEYARHGRFSVKSDVFSFGVLVLEIITGQKNTGFYKSERTQDLISQVWRHWEEGKALELIEPSLEDRYSRTEVMRCIHIGLLCVQEDMRMRPTMASVVL

PatternScan: PS00108
IPR008271
401-413 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox