PRGDB00206993 (Aquca_005_00331.1)

From PRG Wiki
Jump to: navigation, search
Aquca_005_00331.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia coerulea

Comment?

DNA Sequence

ATGGCTTCAAGAAACAATCTTTTCTTGGTTTTCATCTTCTTTCTTCTATCTTTCTTCTTCTTTATTGATTCAACAATGGAAACAGAAGATTTCAATTTAGATTTTTCTTCATTTAGTTTTCGAAATCTTACTCTTCTTGGTGATTCTTATCTTAGAAATGGTGTAGTTGGTCTTACTAGAGAACTTGGTGTTCCTTCTTCTAGTTCTGGTTCTGTAATTTGTACTTCCCCTGTTCCTTTCTTTGATCCTCAAACTAATATCTCTGTTTCTTTTTCAACAAGATTTTCTTTTTCTATTAAAAACATTAATCCTACTTCTTATGGTGATGGTTTAGCTTTCTTTGTTTCTCCTAATAACTATACTCTTGGTAGTTCTGGTGCTTATTTGGGTCTTGTTAATTCTTCTCAACTTACCAAGAACAAGTTTTTCGCAATCGAATTCGATACTCGTTTAGATCCCCTTTTCTCTGATCCTAATGATAATCATATTGGATTAGATATTGATAGTTTGATTTCTATTAAAACAGCTGATGTTTCTTCAAGAGGAATTGATCTTAAAAGTGGGAATTCAATTACTGTTTGGATTGATTACGATAATCATTTCAAGATCTTTAAGGTTTGGATGAGTTATTCAAGTTTTAAACCTGAGAATCCAGTTTTATCGACAGATATCGATCTTTCAGTTTATTTTCAAGATTTTATGTATGTGGGGTTCTCTGCATCAACAGAAGGAAGTACAGAAGTTCATCTTATTCAAGATTGGAAGTTTCGGACTTCTGGATTTCAATTGAAACCAAGGCGTTCTCATCCTTACAATGTGTCTGATAACTCGGTCACTTCTTCGATTCCGGTAATTCCCATCCCCAGTTCTAGTAATAATAAGAGGAAAAAACTCGGTTTAGGCCTTGGAATAGCTTGTCCTGCATTTTTTTGCTTAGTTATTGTGATTTTTGGTTGGTTTTCTGTTAAGAAACTTAAGAAAACCAGTAGAGACAATACTAGCTTTAAACCTGAGCTTCTAAAGAGTCCTCGAGAATTTCGTTATGTAGAACTAAAAGAAGCCACAAAAGGGTTTCATTCGACTCGAATTTTAGGTCATGGATCATTTGGGACTGTTTACAAAGCTATTTTCCCTAAGTCAGAATCGATATTTGCAGTAAAAAGATCTAAACATACTCATGATGGTATGAGTGAATTCATTGCTGAGTTGTCTATTATAGCTTGTTTGAGACACAAAAATCTTGTTCAACTCCAAGGTTGGAGTACTGAGAAAGGTGAATTGCTGCTTGTTTACGAGTATATGTCTAATGGGAGTCTCGATAGGGTTCTGTACAGAGAACCAGAAGAGGGTATCTCCCTTCCATGGCCTCAGAGGTATAATATTGCAGTGGGAATTGCTTCTGTTCTGACCTACATACACCAAGAATGTGAGCAGCAGGTAATTCATAGAGATATAAAGACTAGCAATATAATGTTGGATGGTAACTACAACCCTAGGTTGGGGGATTTTGGCCTAGCTAGGCTTATGGAGCATGATAAGAGCCCAGTTTCGACATTAACTGCAGGGACGATGGGATACCTCGCTCCGGAGTATCTGCAGTATGGAAAAGCGACAGAGAAAACAGATGTTTTCAGTTATGGTGTTGTTTTACTTGAAGTGGCTTGTGGAAGAAGACCTATTGAGAAAGAATCAGACAGTGAGAAAATGGTTAACTTGGTAGACTGGGTATGGGGCCTGTACTCCGAAGACAAGCTTATTGAAGCTGCAGACAAGAGGTTGAAAGGGGAGTTTGATGAAGAAGGAATGATTAAGCTACTGCTTGTAGGTTTGAGTTGCGCAAACCCATCAAGCATAGAGAGACCTTCTATGAGGAGAGTCCTCCAGATCCTTAATAATGAAGCAGAGGTTGTTCATGCACCTAAGACGAAACCAACCCTGACATTCTCTTCCAGCTTGCCGTTGAGTATTGAGGATATTGTTTCCGACTGTGAAGAGAGCGAGAATGCCAGCCCTGAGAAAAATTTCAAAGCCAGCCCTTTGTATGAAATCAGTATCAGATGA


Protein sequences

Name Description Sequence
Aquca_005_00331.1 protein obtained from Pythozome database for gene Aquca_005_00331.1

MASRNNLFLVFIFFLLSFFFFIDSTMETEDFNLDFSSFSFRNLTLLGDSYLRNGVVGLTRELGVPSSSSGSVICTSPVPFFDPQTNISVSFSTRFSFSIKNINPTSYGDGLAFFVSPNNYTLGSSGAYLGLVNSSQLTKNKFFAIEFDTRLDPLFSDPNDNHIGLDIDSLISIKTADVSSRGIDLKSGNSITVWIDYDNHFKIFKVWMSYSSFKPENPVLSTDIDLSVYFQDFMYVGFSASTEGSTEVHLIQDWKFRTSGFQLKPRRSHPYNVSDNSVTSSIPVIPIPSSSNNKRKKLGLGLGIACPAFFCLVIVIFGWFSVKKLKKTSRDNTSFKPELLKSPREFRYVELKEATKGFHSTRILGHGSFGTVYKAIFPKSESIFAVKRSKHTHDGMSEFIAELSIIACLRHKNLVQLQGWSTEKGELLLVYEYMSNGSLDRVLYREPEEGISLPWPQRYNIAVGIASVLTYIHQECEQQVIHRDIKTSNIMLDGNYNPRLGDFGLARLMEHDKSPVSTLTAGTMGYLAPEYLQYGKATEKTDVFSYGVVLLEVACGRRPIEKESDSEKMVNLVDWVWGLYSEDKLIEAADKRLKGEFDEEGMIKLLLVGLSCANPSSIERPSMRRVLQILNNEAEVVHAPKTKPTLTFSSSLPLSIEDIVSDCEESENASPEKNFKASPLYEISIR*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF739
1-659 SUBFAMILY NOT NAMED

MASRNNLFLVFIFFLLSFFFFIDSTMETEDFNLDFSSFSFRNLTLLGDSYLRNGVVGLTRELGVPSSSSGSVICTSPVPFFDPQTNISVSFSTRFSFSIKNINPTSYGDGLAFFVSPNNYTLGSSGAYLGLVNSSQLTKNKFFAIEFDTRLDPLFSDPNDNHIGLDIDSLISIKTADVSSRGIDLKSGNSITVWIDYDNHFKIFKVWMSYSSFKPENPVLSTDIDLSVYFQDFMYVGFSASTEGSTEVHLIQDWKFRTSGFQLKPRRSHPYNVSDNSVTSSIPVIPIPSSSNNKRKKLGLGLGIACPAFFCLVIVIFGWFSVKKLKKTSRDNTSFKPELLKSPREFRYVELKEATKGFHSTRILGHGSFGTVYKAIFPKSESIFAVKRSKHTHDGMSEFIAELSIIACLRHKNLVQLQGWSTEKGELLLVYEYMSNGSLDRVLYREPEEGISLPWPQRYNIAVGIASVLTYIHQECEQQVIHRDIKTSNIMLDGNYNPRLGDFGLARLMEHDKSPVSTLTAGTMGYLAPEYLQYGKATEKTDVFSYGVVLLEVACGRRPIEKESDSEKMVNLVDWVWGLYSEDKLIEAADKRLKGEFDEEGMIKLLLVGLSCANPSSIERPSMRRVLQILNNEAEVVHAPKTKPTLTFSSSLPLSIEDI

HMMPanther: PTHR24420
1-659 FAMILY NOT NAMED,FAMILY NOT NAMED

MASRNNLFLVFIFFLLSFFFFIDSTMETEDFNLDFSSFSFRNLTLLGDSYLRNGVVGLTRELGVPSSSSGSVICTSPVPFFDPQTNISVSFSTRFSFSIKNINPTSYGDGLAFFVSPNNYTLGSSGAYLGLVNSSQLTKNKFFAIEFDTRLDPLFSDPNDNHIGLDIDSLISIKTADVSSRGIDLKSGNSITVWIDYDNHFKIFKVWMSYSSFKPENPVLSTDIDLSVYFQDFMYVGFSASTEGSTEVHLIQDWKFRTSGFQLKPRRSHPYNVSDNSVTSSIPVIPIPSSSNNKRKKLGLGLGIACPAFFCLVIVIFGWFSVKKLKKTSRDNTSFKPELLKSPREFRYVELKEATKGFHSTRILGHGSFGTVYKAIFPKSESIFAVKRSKHTHDGMSEFIAELSIIACLRHKNLVQLQGWSTEKGELLLVYEYMSNGSLDRVLYREPEEGISLPWPQRYNIAVGIASVLTYIHQECEQQVIHRDIKTSNIMLDGNYNPRLGDFGLARLMEHDKSPVSTLTAGTMGYLAPEYLQYGKATEKTDVFSYGVVLLEVACGRRPIEKESDSEKMVNLVDWVWGLYSEDKLIEAADKRLKGEFDEEGMIKLLLVGLSCANPSSIERPSMRRVLQILNNEAEVVHAPKTKPTLTFSSSLPLSIEDI

Seg: seg
7-21 seg

LFLVFIFFLLSFFFF

superfamily: SSF49899
IPR008985
30-260 Concanavalin A-like lectins/glucanases
Concanavalin A-like lectin/glucanase

DFNLDFSSFSFRNLTLLGDSYLRNGVVGLTRELGVPSSSSGSVICTSPVPFFDPQTNISVSFSTRFSFSIKNINPTSYGDGLAFFVSPNNYTLGSSGAYLGLVNSSQLTKNKFFAIEFDTRLDPLFSDPNDNHIGLDIDSLISIKTADVSSRGIDLKSGNSITVWIDYDNHFKIFKVWMSYSSFKPENPVLSTDIDLSVYFQDFMYVGFSASTEGSTEVHLIQDWKFRTSG

Gene3D: G3DSA:2.60.120.200
IPR013320
31-263 no description
Concanavalin A-like lectin/glucanase, subgroup

FNLDFSSFSFRNLTLLGDSYLRNGVVGLTRELGVPSSSSGSVICTSPVPFFDPQTNISVSFSTRFSFSIKNINPTSYGDGLAFFVSPNNYTLGSSGAYLGLVNSSQLTKNKFFAIEFDTRLDPLFSDPNDNHIGLDIDSLISIKTADVSSRGIDLKSGNSITVWIDYDNHFKIFKVWMSYSSFKPENPVLSTDIDLSVYFQDFMYVGFSASTEGSTEVHLIQDWKFRTSGFQL

HMMPfam: PF00139
IPR001220
32-257 Lectin_legB
Legume lectin domain

NLDFSSFSFRNLTLLGDSYLRNGVVGLTRELGVPSSSSGSVICTSPVPFFDPQTNISVSFSTRFSFSIKNINPTSYGDGLAFFVSPNNYTLGSSGAYLGLVNSSQLTKNKFFAIEFDTRLDPLFSDPNDNHIGLDIDSLISIKTADVSSRGIDLKSGNSITVWIDYDNHFKIFKVWMSYSSFKPENPVLSTDIDLSVYFQDFMYVGFSASTEGSTEVHLIQDWKFR

Seg: seg
276-293 seg

NSVTSSIPVIPIPSSSNN

superfamily: SSF56112
IPR011009
328-630 Protein kinase-like (PK-like)
Protein kinase-like domain

TSRDNTSFKPELLKSPREFRYVELKEATKGFHSTRILGHGSFGTVYKAIFPKSESIFAVKRSKHTHDGMSEFIAELSIIACLRHKNLVQLQGWSTEKGELLLVYEYMSNGSLDRVLYREPEEGISLPWPQRYNIAVGIASVLTYIHQECEQQVIHRDIKTSNIMLDGNYNPRLGDFGLARLMEHDKSPVSTLTAGTMGYLAPEYLQYGKATEKTDVFSYGVVLLEVACGRRPIEKESDSEKMVNLVDWVWGLYSEDKLIEAADKRLKGEFDEEGMIKLLLVGLSCANPSSIERPSMRRVLQIL

Gene3D: G3DSA:3.30.200.20
341-419 no description

KSPREFRYVELKEATKGFHSTRILGHGSFGTVYKAIFPKSESIFAVKRSKHTHDGMSEFIAELSIIACLRHKNLVQLQG

HMMSmart: SM00220
IPR002290
358-629 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FHSTRILGHGSFGTVYKAIFPKSESIFAVKRSKHTHDGMSEFIAELSIIACLRHKNLVQLQGWSTEKGELLLVYEYMSNGSLDRVLYREPEEGISLPWPQRYNIAVGIASVLTYIHQECEQQVIHRDIKTSNIMLDGNYNPRLGDFGLARLMEHDKSPVSTLTAGTMGYLAPEYLQYGKATEKTDVFSYGVVLLEVACGRRPIEKESDSEKMVNLVDWVWGLYSEDKLIEAADKRLKGEFDEEGMIKLLLVGLSCANPSSIERPSMRRVLQI

ProfileScan: PS50011
IPR000719
358-686 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FHSTRILGHGSFGTVYKAIFPKSESIFAVKRSKHTHDGMSEFIAELSIIACLRHKNLVQLQGWSTEKGELLLVYEYMSNGSLDRVLYREPEEGISLPWPQRYNIAVGIASVLTYIHQECEQQVIHRDIKTSNIMLDGNYNPRLGDFGLARLMEHDKSPVSTLTAGTMGYLAPEYLQYGKATEKTDVFSYGVVLLEVACGRRPIEKESDSEKMVNLVDWVWGLYSEDKLIEAADKRLKGEFDEEGMIKLLLVGLSCANPSSIERPSMRRVLQILNNEAEVVHAPKTKPTLTFSSSLPLSIEDIVSDCEESENASPEKNFKASPLYEISIR

HMMSmart: SM00219
IPR020635
358-630 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FHSTRILGHGSFGTVYKAIFPKSESIFAVKRSKHTHDGMSEFIAELSIIACLRHKNLVQLQGWSTEKGELLLVYEYMSNGSLDRVLYREPEEGISLPWPQRYNIAVGIASVLTYIHQECEQQVIHRDIKTSNIMLDGNYNPRLGDFGLARLMEHDKSPVSTLTAGTMGYLAPEYLQYGKATEKTDVFSYGVVLLEVACGRRPIEKESDSEKMVNLVDWVWGLYSEDKLIEAADKRLKGEFDEEGMIKLLLVGLSCANPSSIERPSMRRVLQIL

HMMPfam: PF00069
IPR000719
359-572 Pkinase,Ser-thr
Protein kinase, catalytic domain

HSTRILGHGSFGTVYKAIFPKSESIFAVKRSKHTHDGMSEFIAELSIIACLRHKNLVQLQGWSTEKGELLLVYEYMSNGSLDRVLYREPEEGISLPWPQRYNIAVGIASVLTYIHQECEQQVIHRDIKTSNIMLDGNYNPRLGDFGLARLMEHDKSPVSTLTAGTMGYLAPEYLQYGKATEKTDVFSYGVVLLEVACGRRPIEKESDSEKMVNL

PatternScan: PS00107
IPR017441
364-387 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGHGSFGTVYKAIFPKSESIFAVK

Gene3D: G3DSA:1.10.510.10
420-628 no description

WSTEKGELLLVYEYMSNGSLDRVLYREPEEGISLPWPQRYNIAVGIASVLTYIHQECEQQVIHRDIKTSNIMLDGNYNPRLGDFGLARLMEHDKSPVSTLTAGTMGYLAPEYLQYGKATEKTDVFSYGVVLLEVACGRRPIEKESDSEKMVNLVDWVWGLYSEDKLIEAADKRLKGEFDEEGMIKLLLVGLSCANPSSIERPSMRRVLQ

PatternScan: PS00108
IPR008271
480-492 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKTSNIML

Seg: seg
640-655 seg

PKTKPTLTFSSSLPLS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox