PRGDB00209696 (Eucgr.C04351.1)

From PRG Wiki
Jump to: navigation, search
Eucgr.C04351.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Eucalyptus grandis

Comment?

DNA Sequence

ATGGCTTCAGTGATGCTCCGAATCCTTCTGCTGCTCGTTACCCTTCCACTTTCCGCCAAAGCTCAGACCAACGGCAACCTCACCTTGGGCTCCTCGTTAACGGCGGATGACCAGAACTCTTCCTGGCTGTCTCCGTCAGGCGAGTTCACCTTCGGGTTCCGGAAAATGGGACAAGGGGCTCATTTGCTGGCAATATGGTTTGAGAAGATAGAGGACAAGACCATTGTCTGGTCGGCGAATGGTGATAATTTAGCGCCAGAAGGCTCGAAGATCCAAGAGTTGTGGTCTCCTAGCCCGACTGTCGCTGGTGTAGCGCATGCGGCCATGCTTGACACGGGAAACTTTGTCCTAGTTAGCCAGAACTACGTCAACTTGTGGGAGACGTTCAGCCAATCAACCGACACGATACTGCCTACGCAACAGTTAGATCAAGGGACTAAAGTTAACTCTCACTACTCTGAAATGAATTACTCCACCGGGAGATTCCACTTCAAGCTAGGAGATGACGGAAATCTCGCATTCTATGCCACTTCTAACCCGTGGCTTGCCTCAGATACTTACTGGGTCAGCAACACCAAAGATAGCGGCTTTGGATTGATATTAAATCAAAGTGGTCAGGTCTACCTTACGGCTAGGAATGGAACACTGCTCAAACTTATCACCTTAGACACAGTCCCGACCAACGAGTTTTACCAAAGAGCAATCCTTGAATACGATGGGGTCTTCAGGCAATATGTCCACCCTAAGGGGGCAAATTCAAGTTCTGCCTTGGCACTGGGCTGGTCGATGAGCATCAGGCAAACTACGGGTTCTGGAGCTTGTGGCTTCAACAGTTACTGTGCTCTTGGAGACGACCAGAGGCCCCGATGCCAATGCCCACCCGGATATACTCCATTAGATTCAACAAACGAGATGAATGAATGCAGGAAGGACTTCGTACCGCAGAGTTGTGATGGAAGTAGGCCGGAAACAGACCAATTTGCTTTGCATGAAATGCTCCGTACAAACTGGCAAAGGAATGATTACGAGCGTACTGCAGCACAAACCGAGGACAGGTGCAGAGAGGCTTGTTTGGCTGATTGTTTTTTCGCAGTTGCTATTTTTGGCGGCAGCGGAACTTGCTACAAAAAGAATCCAATGGAAGGATGGATCCTAATGGAAACAAGAATTCCACTGATTATCATCGAATCGGTGTTGTTGAGTAGCTCTGTGTTTGTGAACTTGCTTCTACTCCTCATCACCTATTTAATTTACAGAAGCTTCCGATCTAGGGATTCTAAGTTGTCACGACCAGTCCAGATCAACCAAGCCACAGGTATGCAGACTTTCACTTATCAGGAGCTTCAAGAAGCAACAGATGAATTCAAAGAAGAACTAGGTAGGGGTGCTTTTGGAACAGTGTACAAAGGTGTTCTTGGATCCGAGGATACAAACTTTGTGGTAGTAAAAGTGCTGGCAACAAGGACTGGAGAAAGGGAAAAGGAGTTTGAAAGAGAAGTGAGTGCAATTGGCCAGACTAACCACAAGCACTTAGTGCAGTTGCTTGGATTCTGCAATGAAGGTCAACATCGACTACTGGTGTATGAATTCATGAGCAACAGCACTTTGGCAGATTTTCTATTTGGCATTTCAAAGCCCACCTGGTACAAAAGAATAGAAATTGCCTGTGTCAGAGGGACCAGAGGTTATTTAGCGCCAGAATGGTTCAGGAATATGCCTATTTCTAGTAAGGTAGACGTTTACAGCTTCAGCATTTTGTTGGTTGAGCTCATCTGCTGCAGAAAGAACTATGAGCCGGGAGCTGAAATTGAAGCTCAAATTGTACTGGTCGACTGGGTCTATGACTGTTACCTCGATGGGAATGTACTTTCGCTCGTGGAGAGTGATGAGGAGGCATCAAACGACATGAGGAGGGTGAGAAGATTTGTGATGACAACATTGTGGTGCATCCAGGAAGACCCGGCTTTGAGGCCAGCCATGAACAAAATCACTCAGATGTTGGAAGGAGCTGTTGAAGTCCCAGTACCTCCAGTTTCAAGCTTGTTTATCATAAGTTTTGCCTGA


Protein sequences

Name Description Sequence
Eucgr.C04351.1 protein obtained from Pythozome database for gene Eucgr.C04351.1

MASVMLRILLLLVTLPLSAKAQTNGNLTLGSSLTADDQNSSWLSPSGEFTFGFRKMGQGAHLLAIWFEKIEDKTIVWSANGDNLAPEGSKIQELWSPSPTVAGVAHAAMLDTGNFVLVSQNYVNLWETFSQSTDTILPTQQLDQGTKVNSHYSEMNYSTGRFHFKLGDDGNLAFYATSNPWLASDTYWVSNTKDSGFGLILNQSGQVYLTARNGTLLKLITLDTVPTNEFYQRAILEYDGVFRQYVHPKGANSSSALALGWSMSIRQTTGSGACGFNSYCALGDDQRPRCQCPPGYTPLDSTNEMNECRKDFVPQSCDGSRPETDQFALHEMLRTNWQRNDYERTAAQTEDRCREACLADCFFAVAIFGGSGTCYKKNPMEGWILMETRIPLIIIESVLLSSSVFVNLLLLLITYLIYRSFRSRDSKLSRPVQINQATGMQTFTYQELQEATDEFKEELGRGAFGTVYKGVLGSEDTNFVVVKVLATRTGEREKEFEREVSAIGQTNHKHLVQLLGFCNEGQHRLLVYEFMSNSTLADFLFGISKPTWYKRIEIACVRGTRGYLAPEWFRNMPISSKVDVYSFSILLVELICCRKNYEPGAEIEAQIVLVDWVYDCYLDGNVLSLVESDEEASNDMRRVRRFVMTTLWCIQEDPALRPAMNKITQMLEGAVEVPVPPVSSLFIISFA*

Domains

Domain Start-End Description Sequence

Seg: seg
6-17 seg

LRILLLLVTLPL

ProfileScan: PS50927
IPR001480
24-162 BULB_LECTIN
Bulb-type lectin domain

NGNLTLGSSLTADDQNSSWLSPSGEFTFGFRKMGQGAHLLAIWFEKIEDKTIVWSANGDNLAPEGSKIQELWSPSPTVAGVAHAAMLDTGNFVLVSQNYVNLWETFSQSTDTILPTQQLDQGTKVNSHYSEMNYSTGRF

HMMSmart: SM00108
IPR001480
26-132 Bulb-type mannose-specific lectin
Bulb-type lectin domain

NLTLGSSLTADDQNSSWLSPSGEFTFGFRKMGQGAHLLAIWFEKIEDKTIVWSANGDNLAPEGSKIQELWSPSPTVAGVAHAAMLDTGNFVLVSQNYVNLWETFSQS

HMMPanther: PTHR24420:SF815
40-677 RLK1 (RECEPTOR-LIKE PROTEIN KINASE 1); CARBOHYDRATE BINDING / KINASE

SSWLSPSGEFTFGFRKMGQGAHLLAIWFEKIEDKTIVWSANGDNLAPEGSKIQELWSPSPTVAGVAHAAMLDTGNFVLVSQNYVNLWETFSQSTDTILPTQQLDQGTKVNSHYSEMNYSTGRFHFKLGDDGNLAFYATSNPWLASDTYWVSNTKDSGFGLILNQSGQVYLTARNGTLLKLITLDTVPTNEFYQRAILEYDGVFRQYVHPKGANSSSALALGWSMSIRQTTGSGACGFNSYCALGDDQRPRCQCPPGYTPLDSTNEMNECRKDFVPQSCDGSRPETDQFALHEMLRTNWQRNDYERTAAQTEDRCREACLADCFFAVAIFGGSGTCYKKNPMEGWILMETRIPLIIIESVLLSSSVFVNLLLLLITYLIYRSFRSRDSKLSRPVQINQATGMQTFTYQELQEATDEFKEELGRGAFGTVYKGVLGSEDTNFVVVKVLATRTGEREKEFEREVSAIGQTNHKHLVQLLGFCNEGQHRLLVYEFMSNSTLADFLFGISKPTWYKRIEIACVRGTRGYLAPEWFRNMPISSKVDVYSFSILLVELICCRKNYEPGAEIEAQIVLVDWVYDCYLDGNVLSLVESDEEASNDMRRVRRFVMTTLWCIQEDPALRPAMNKITQMLEGAVEVPVPP

HMMPanther: PTHR24420
40-677 FAMILY NOT NAMED,FAMILY NOT NAMED

SSWLSPSGEFTFGFRKMGQGAHLLAIWFEKIEDKTIVWSANGDNLAPEGSKIQELWSPSPTVAGVAHAAMLDTGNFVLVSQNYVNLWETFSQSTDTILPTQQLDQGTKVNSHYSEMNYSTGRFHFKLGDDGNLAFYATSNPWLASDTYWVSNTKDSGFGLILNQSGQVYLTARNGTLLKLITLDTVPTNEFYQRAILEYDGVFRQYVHPKGANSSSALALGWSMSIRQTTGSGACGFNSYCALGDDQRPRCQCPPGYTPLDSTNEMNECRKDFVPQSCDGSRPETDQFALHEMLRTNWQRNDYERTAAQTEDRCREACLADCFFAVAIFGGSGTCYKKNPMEGWILMETRIPLIIIESVLLSSSVFVNLLLLLITYLIYRSFRSRDSKLSRPVQINQATGMQTFTYQELQEATDEFKEELGRGAFGTVYKGVLGSEDTNFVVVKVLATRTGEREKEFEREVSAIGQTNHKHLVQLLGFCNEGQHRLLVYEFMSNSTLADFLFGISKPTWYKRIEIACVRGTRGYLAPEWFRNMPISSKVDVYSFSILLVELICCRKNYEPGAEIEAQIVLVDWVYDCYLDGNVLSLVESDEEASNDMRRVRRFVMTTLWCIQEDPALRPAMNKITQMLEGAVEVPVPP

superfamily: SSF51110
IPR001480
60-188 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

AHLLAIWFEKIEDKTIVWSANGDNLAPEGSKIQELWSPSPTVAGVAHAAMLDTGNFVLVSQNYVNLWETFSQSTDTILPTQQLDQGTKVNSHYSEMNYSTGRFHFKLGDDGNLAFYATSNPWLASDTYW

Gene3D: G3DSA:2.90.10.10
IPR001480
88-193 no description
Bulb-type lectin domain

GSKIQELWSPSPTVAGVAHAAMLDTGNFVLVSQNYVNLWETFSQSTDTILPTQQLDQGTKVNSHYSEMNYSTGRFHFKLGDDGNLAFYATSNPWLASDTYWVSNTK

HMMPfam: PF01453
IPR001480
91-150 B_lectin
Bulb-type lectin domain

IQELWSPSPTVAGVAHAAMLDTGNFVLVSQNYVNLWETFSQSTDTILPTQQLDQGTKVNS

Seg: seg
390-417 seg

IPLIIIESVLLSSSVFVNLLLLLITYLI

superfamily: SSF56112
IPR011009
427-686 Protein kinase-like (PK-like)
Protein kinase-like domain

KLSRPVQINQATGMQTFTYQELQEATDEFKEELGRGAFGTVYKGVLGSEDTNFVVVKVLATRTGEREKEFEREVSAIGQTNHKHLVQLLGFCNEGQHRLLVYEFMSNSTLADFLFGISKPTWYKRIEIACVRGTRGYLAPEWFRNMPISSKVDVYSFSILLVELICCRKNYEPGAEIEAQIVLVDWVYDCYLDGNVLSLVESDEEASNDMRRVRRFVMTTLWCIQEDPALRPAMNKITQMLEGAVEVPVPPVSSLFIISF

Gene3D: G3DSA:3.30.200.20
436-531 no description

QATGMQTFTYQELQEATDEFKEELGRGAFGTVYKGVLGSEDTNFVVVKVLATRTGEREKEFEREVSAIGQTNHKHLVQLLGFCNEGQHRLLVYEFM

ProfileScan: PS50011
IPR000719
453-687 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

DEFKEELGRGAFGTVYKGVLGSEDTNFVVVKVLATRTGEREKEFEREVSAIGQTNHKHLVQLLGFCNEGQHRLLVYEFMSNSTLADFLFGISKPTWYKRIEIACVRGTRGYLAPEWFRNMPISSKVDVYSFSILLVELICCRKNYEPGAEIEAQIVLVDWVYDCYLDGNVLSLVESDEEASNDMRRVRRFVMTTLWCIQEDPALRPAMNKITQMLEGAVEVPVPPVSSLFIISFA

HMMSmart: SM00219
IPR020635
453-667 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

DEFKEELGRGAFGTVYKGVLGSEDTNFVVVKVLATRTGEREKEFEREVSAIGQTNHKHLVQLLGFCNEGQHRLLVYEFMSNSTLADFLFGISKPTWYKRIEIACVRGTRGYLAPEWFRNMPISSKVDVYSFSILLVELICCRKNYEPGAEIEAQIVLVDWVYDCYLDGNVLSLVESDEEASNDMRRVRRFVMTTLWCIQEDPALRPAMNKITQML

HMMSmart: SM00220
IPR002290
453-667 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

DEFKEELGRGAFGTVYKGVLGSEDTNFVVVKVLATRTGEREKEFEREVSAIGQTNHKHLVQLLGFCNEGQHRLLVYEFMSNSTLADFLFGISKPTWYKRIEIACVRGTRGYLAPEWFRNMPISSKVDVYSFSILLVELICCRKNYEPGAEIEAQIVLVDWVYDCYLDGNVLSLVESDEEASNDMRRVRRFVMTTLWCIQEDPALRPAMNKITQML

HMMPfam: PF07714
IPR001245
455-540 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

FKEELGRGAFGTVYKGVLGSEDTNFVVVKVLATRTGEREKEFEREVSAIGQTNHKHLVQLLGFCNEGQHRLLVYEFMSNSTLADFL

PatternScan: PS00107
IPR017441
459-483 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGAFGTVYKGVLGSEDTNFVVVK

Gene3D: G3DSA:1.10.510.10
541-670 no description

FGISKPTWYKRIEIACVRGTRGYLAPEWFRNMPISSKVDVYSFSILLVELICCRKNYEPGAEIEAQIVLVDWVYDCYLDGNVLSLVESDEEASNDMRRVRRFVMTTLWCIQEDPALRPAMNKITQMLEGA

HMMPfam: PF00069
IPR000719
541-665 Pkinase,Ser-thr
Protein kinase, catalytic domain

FGISKPTWYKRIEIACVRGTRGYLAPEWFRNMPISSKVDVYSFSILLVELICCRKNYEPGAEIEAQIVLVDWVYDCYLDGNVLSLVESDEEASNDMRRVRRFVMTTLWCIQEDPALRPAMNKITQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox