PRGDB00218624 (Thhalv10000647m)

From PRG Wiki
Jump to: navigation, search
Thhalv10000647m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Eutrema halophilum

Comment?

DNA Sequence

ATGGCCTCTCCTTCTTTTAAGCCTCGCAACTACAAAGTCAATGTCTTTTCGAGCTTCCACAGGCCTGACGTCCGTAAAACACTTCTTAGTCACATGCGTGAACAGTTCAAACGCACGGGGATCACTATGTTTGATGATCAAGAGATTGAGAGAAGCGCAATAATCGCTCCTTCACTCATAGAAGCTATAAGAGAATCAAGGATCTCGATCGTAATTCTCTCCAAGAAATATGCTTCGTCAAGCTGGTGTTTGGATGAATTGGTGGAGATATTAGAGTGCAAAAAAGCTGGACAGACAGTGATGACCATCTTCTACGGAGTGCATCCATCCGATATACGGAAACAGACTGGAGAATTCGGGAACACATTCAATGAAACGTGTGCACATAAGACGGACCAGGAAAGGCAGAAATGGAGCAAAGCTTTAAACGATGTGGGAAACATTGCTGGAGAAGACTTTTTAAAATGGGATAATGAAGCAATAATGATCAAGAAGATTGCCAGAGATGTTTCAGATAAATTGAATGCTACACCATCTAGGGATTTTGATGGCATGGTTGGACTAAAAGCACATCTGAGAGACATGCAATCTTTGTTGCATTTAGATTATAAGGATGGAGCTATGATTGTTGGAATCTGTGGCCCTGCAGGCATTGGTAAGACTACCAGTGCCAGGGCTTTGTATAGCAGACTCTCTTGCAGTTTTCAGCTTACTTGTTTTATGGATAATCTTAGGGGAAGCTATCATAGTGGTCTTGACGAGTACGGATTGAAGCTCTGTCTACAAGAGCAACTTCTTTCAAAGATTTTGAACCAAAATGATATTAGGATAAGCCGTCTAGGTGTGAAAAAAGAAAGGCTACGCGACCACAAAGTGCTCATAATTCTTGATGATGTGAACAATATAAAGCAATTGGAGGCATTGGCAAATGAAACTACATGGTTTGGTCCTGGAAGTAAGATTATAGTTACAACAGAAAACAAAGACCTTTTGCAGCAACATGGAATCAACAATACATACCATGTGGGGTTTCCATCTAGAAAAGAAGCTCTTGAGATCTTATGTAGATATGCTTTGAAACAAAGCTATCCACATGATCATAGTTTTGAGGTGCTTGCTAAAAGGATAATAGAGCTTTGTGGTAACCTTCCATTGGGTCTACGTGTGGTGGGTTCATCTTTACGTGGGAAGAAGGAGTACGAATGGGAAGACGTAATAAACAGGCTAGAAACTATCATTGATAGAGATCTTGAGGACGTACTAAGAGTCGGTTATGAGAGTTTAGATGAGAATGAACAATCTCTGTTTCTCCACATTGCAGTCTTCTTCAAATATCAAGATGGAGATCTTGTGAAAACCATGTTCTCTGACAGTTACTTAGATGCCAAACGTGGTCTGAAGATCCTAGTCAATAGATCTCTTATAAAGATATCTAAATATGGGGAGAGAATACAGATGCATAGATTACTACGACAAGTGGGTCAAAAAGCCATTCATAAACAAGAGCCTTGGAAACGCCAAATTTTAATGGATGGTGATGAGATCTGTGATGTTCTGGAACTTGCCAAAGGTACAAGAGTTGTGTCTGGCATCTCATTTGATACATCAGGAACCAACGAAGTGATTGTTAGCGAAAGAGCCTTTAAAAGAATGCCTAATCTTCGATTCCTCAAAGTTTACAAAAGCAGATATGATGAAAATGATGTGATGCATAAACCTGGGGAGATGGAGTTTCCGCGTCGTCTAAGGTTACTACATTGGGAGGAATACCCGAGCAAGAGTCCTCCTCTTACATTTCATCCGGAATATCTTGTGGAAATGAATATGAAGCATAGCAAGCTAGAGTACCTCTGGCAAGGAACTCAGGTTACCCATGTCAGCTGCTCATGGATTCTGGTATTAAATCTTGGGTTATGCGGTCATACAATCCTATAA


Protein sequences

Name Description Sequence
Thhalv10000647m protein obtained from Pythozome database for gene Thhalv10000647m

MASPSFKPRNYKVNVFSSFHRPDVRKTLLSHMREQFKRTGITMFDDQEIERSAIIAPSLIEAIRESRISIVILSKKYASSSWCLDELVEILECKKAGQTVMTIFYGVHPSDIRKQTGEFGNTFNETCAHKTDQERQKWSKALNDVGNIAGEDFLKWDNEAIMIKKIARDVSDKLNATPSRDFDGMVGLKAHLRDMQSLLHLDYKDGAMIVGICGPAGIGKTTSARALYSRLSCSFQLTCFMDNLRGSYHSGLDEYGLKLCLQEQLLSKILNQNDIRISRLGVKKERLRDHKVLIILDDVNNIKQLEALANETTWFGPGSKIIVTTENKDLLQQHGINNTYHVGFPSRKEALEILCRYALKQSYPHDHSFEVLAKRIIELCGNLPLGLRVVGSSLRGKKEYEWEDVINRLETIIDRDLEDVLRVGYESLDENEQSLFLHIAVFFKYQDGDLVKTMFSDSYLDAKRGLKILVNRSLIKISKYGERIQMHRLLRQVGQKAIHKQEPWKRQILMDGDEICDVLELAKGTRVVSGISFDTSGTNEVIVSERAFKRMPNLRFLKVYKSRYDENDVMHKPGEMEFPRRLRLLHWEEYPSKSPPLTFHPEYLVEMNMKHSKLEYLWQGTQVTHVSCSWILVLNLGLCGHTIL*

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.10140
9-145 no description

RNYKVNVFSSFHRPDVRKTLLSHMREQFKRTGITMFDDQEIERSAIIAPSLIEAIRESRISIVILSKKYASSSWCLDELVEILECKKAGQTVMTIFYGVHPSDIRKQTGEFGNTFNETCAHKTDQERQKWSKALNDV

ProfileScan: PS50104
IPR000157
11-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

YKVNVFSSFHRPDVRKTLLSHMREQFKRTGITMFDDQEIERSAIIAPSLIEAIRESRISIVILSKKYASSSWCLDELVEILECKKAGQTVMTIFYGVHPSDIRKQTGEFGNTFNETCAHKTDQERQKWSKALNDVGNI

HMMSmart: SM00255
IPR000157
12-148 Toll
Toll/interleukin-1 receptor homology (TIR) domain

KVNVFSSFHRPDVRKTLLSHMREQFKRTGITMFDDQEIERSAIIAPSLIEAIRESRISIVILSKKYASSSWCLDELVEILECKKAGQTVMTIFYGVHPSDIRKQTGEFGNTFNETCAHKTDQERQKWSKALNDVGNI

HMMPfam: PF01582
IPR000157
15-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFSSFHRPDVRKTLLSHMREQFKRTGITMFDDQEIERSAIIAPSLIEAIRESRISIVILSKKYASSSWCLDELVEILECKKAGQTVMTIFYGVHPSDIRKQTGEFGNTFNETCAHKTDQERQKWSKALN

HMMPanther: PTHR11017:SF20
35-622 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

QFKRTGITMFDDQEIERSAIIAPSLIEAIRESRISIVILSKKYASSSWCLDELVEILECKKAGQTVMTIFYGVHPSDIRKQTGEFGNTFNETCAHKTDQERQKWSKALNDVGNIAGEDFLKWDNEAIMIKKIARDVSDKLNATPSRDFDGMVGLKAHLRDMQSLLHLDYKDGAMIVGICGPAGIGKTTSARALYSRLSCSFQLTCFMDNLRGSYHSGLDEYGLKLCLQEQLLSKILNQNDIRISRLGVKKERLRDHKVLIILDDVNNIKQLEALANETTWFGPGSKIIVTTENKDLLQQHGINNTYHVGFPSRKEALEILCRYALKQSYPHDHSFEVLAKRIIELCGNLPLGLRVVGSSLRGKKEYEWEDVINRLETIIDRDLEDVLRVGYESLDENEQSLFLHIAVFFKYQDGDLVKTMFSDSYLDAKRGLKILVNRSLIKISKYGERIQMHRLLRQVGQKAIHKQEPWKRQILMDGDEICDVLELAKGTRVVSGISFDTSGTNEVIVSERAFKRMPNLRFLKVYKSRYDENDVMHKPGEMEFPRRLRLLHWEEYPSKSPPLTFHPEYLVEMNMKHSKLEYLWQGTQ

HMMPanther: PTHR11017
35-622 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QFKRTGITMFDDQEIERSAIIAPSLIEAIRESRISIVILSKKYASSSWCLDELVEILECKKAGQTVMTIFYGVHPSDIRKQTGEFGNTFNETCAHKTDQERQKWSKALNDVGNIAGEDFLKWDNEAIMIKKIARDVSDKLNATPSRDFDGMVGLKAHLRDMQSLLHLDYKDGAMIVGICGPAGIGKTTSARALYSRLSCSFQLTCFMDNLRGSYHSGLDEYGLKLCLQEQLLSKILNQNDIRISRLGVKKERLRDHKVLIILDDVNNIKQLEALANETTWFGPGSKIIVTTENKDLLQQHGINNTYHVGFPSRKEALEILCRYALKQSYPHDHSFEVLAKRIIELCGNLPLGLRVVGSSLRGKKEYEWEDVINRLETIIDRDLEDVLRVGYESLDENEQSLFLHIAVFFKYQDGDLVKTMFSDSYLDAKRGLKILVNRSLIKISKYGERIQMHRLLRQVGQKAIHKQEPWKRQILMDGDEICDVLELAKGTRVVSGISFDTSGTNEVIVSERAFKRMPNLRFLKVYKSRYDENDVMHKPGEMEFPRRLRLLHWEEYPSKSPPLTFHPEYLVEMNMKHSKLEYLWQGTQ

superfamily: SSF52540
66-437 P-loop containing nucleoside triphosphate hydrolases

SRISIVILSKKYASSSWCLDELVEILECKKAGQTVMTIFYGVHPSDIRKQTGEFGNTFNETCAHKTDQERQKWSKALNDVGNIAGEDFLKWDNEAIMIKKIARDVSDKLNATPSRDFDGMVGLKAHLRDMQSLLHLDYKDGAMIVGICGPAGIGKTTSARALYSRLSCSFQLTCFMDNLRGSYHSGLDEYGLKLCLQEQLLSKILNQNDIRISRLGVKKERLRDHKVLIILDDVNNIKQLEALANETTWFGPGSKIIVTTENKDLLQQHGINNTYHVGFPSRKEALEILCRYALKQSYPHDHSFEVLAKRIIELCGNLPLGLRVVGSSLRGKKEYEWEDVINRLETIIDRDLEDVLRVGYESLDENEQSLFL

Gene3D: G3DSA:3.40.50.300
178-333 no description

PSRDFDGMVGLKAHLRDMQSLLHLDYKDGAMIVGICGPAGIGKTTSARALYSRLSCSFQLTCFMDNLRGSYHSGLDEYGLKLCLQEQLLSKILNQNDIRISRLGVKKERLRDHKVLIILDDVNNIKQLEALANETTWFGPGSKIIVTTENKDLLQQ

HMMPfam: PF00931
IPR002182
198-447 NB-ARC,NBS
NB-ARC

LLHLDYKDGAMIVGICGPAGIGKTTSARALYSRLSCSFQLTCFMDNLRGSYHSGLDEYGLKLCLQEQLLSKILNQNDIRISRLGVKKERLRDHKVLIILDDVNNIKQLEALANETTWFGPGSKIIVTTENKDLLQQHGINNTYHVGFPSRKEALEILCRYALKQSYPHDHSFEVLAKRIIELCGNLPLGLRVVGSSLRGKKEYEWEDVINRLETIIDRDLEDVLRVGYESLDENEQSLFLHIAVFFKYQD

HMMSmart: SM00382
IPR003593
206-419 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

GAMIVGICGPAGIGKTTSARALYSRLSCSFQLTCFMDNLRGSYHSGLDEYGLKLCLQEQLLSKILNQNDIRISRLGVKKERLRDHKVLIILDDVNNIKQLEALANETTWFGPGSKIIVTTENKDLLQQHGINNTYHVGFPSRKEALEILCRYALKQSYPHDHSFEVLAKRIIELCGNLPLGLRVVGSSLRGKKEYEWEDVINRLETIIDRDLED

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

IVGICGPAGIGKTTSA

FPrintScan: PR00364
IPR000767
286-300 DISEASERSIST
Disease resistance protein

RLRDHKVLIILDDVN

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

CGNLPLGLRVVGSSL

HMMPfam: PF07725
IPR011713
603-622 LRR_3
Leucine-rich repeat 3

YLVEMNMKHSKLEYLWQGTQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox