PRGDB00218625 (Thhalv10000051m)

From PRG Wiki
Jump to: navigation, search
Thhalv10000051m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type NBS, Ser-Thr Kinase
Gene Species Eutrema halophilum

Comment?

DNA Sequence

ATGTGGATGGCGAAGAACAATAACGTGGGAAACAAGGAAGGAGGAGGATCGTCCGGAGTTGTGGCTGTTGCTATAGACAAAGACAAAAGCAGCCAACACGCACTTAAATGGGCCGTTGATCATTTGTTGCAGAGAGGCCAATCTGTTATTCTCGTCCATGTCAAGCTTCGACCTTCCCCTTTGACCAATAGCCCTTCTCTTCATGCTTCTTCTGCAAAGCTGAGCCAGGATTCTTCATTGGTTTGTAGAGATCCAGAAGGCGCTTCCAAGGAGATATTCCTTCCTTTCCGTTGCTTCTGCACGCGCAAAGATATTCAATGCCAAGATGTGTTGCTTGAGGAGTACGATGTAGCAAAAGCTTTAGTCGAATATGCAAACCAAGCCGCCATTGAAGTTTTGGTGGTTGGTTCCTCCAACAAAGGTGGTTTTCTCAGGTTCAACAAGCCTACAGATATTCCAGGGACCATAGCAAAAACCGCACCTGATTTCTGCACAGTTTATGTCATATCCAAAGGAAAGATTTCAACAATGAGATCAGCTTCTCGTTCTGCACCAACGACTGCTCCTCTACGCAGTCCTATTCAACCACCTAGCTTAAAGCCACCTCAACCTGTGCCTTCTACTTCCACCAACATGCGAGCTGAGAGACGGTCTTTTGAGTCTCAACAACGCAGGTCTATGGAAGAGCAACAACGCAGATCCATGGAGGATCAACAACGCAGGTCCATGGAAGATCAACAACGCAGGTCTATGGAGGATCAATCAGAGTCATTCAGATCTCCTTTTACTAGAAGAGGCTATGGGAGATCATACGGGGACTTATCTGTTCCGGAATCAGACATATCCTTTGTCAGTTCTGGTAGACCAAGCATTGATCGTATCTTCCCTAATATTTATGACAATAATGATCCAAACCGAACCCCTCCTAGGCTATCAAATTTCTCTGATATGGACTATAGTCCTAGCATTGATCAGTCCTCCAACTATGGAAGGAGATCAGTGGACATAAGCTCACCTACTGATTATTCGTCTGGCTCGTTTGATAGTAATGAAAGGTTTTCATCTGCTTCAGCAATGGATGATGTAGAGTCTGAGATGAGGAGGCTTAAACTGGAGCTGAAGCAGACAATAGAAATGTACAGTACAGCTTGCAAAGAAGCACTTACAGCAAAACAGAAGGCGACTGAGCTTCAGCGATGGAAGTTAGAAGAAGAGAGGAAGCTGGAAGAGGCAAGACTTGCAGAGGAAGCAGCATTAGCCATTGCAGAGAAAGAGAAAGCAAAGTCCAAAGCAGCTATGGAGGCAGCTGAGGCAGCTCAGAGGATAGCTGAACTCGAGGCTAAGAAGAGAGTTAACGCGGAAATGAAAGCTCTCAAGGAGTCTGAAGAGAAAACAAAGGCCCTTACCGCTTTAGCAAACTCAGACGTAAGGTATAGGAAGTACTCCATTGAAGAGATTGAGAGTGCAACCGAGTTTTTCGCTGAGAAATACAAGATTGGAGAAGGTGGTTATGGACCTGTATACAAATGCTATCTTGATCACACACCAGTTGCTGTTAAAGTTCTTCGTCCGGATGCAGCCCAAGGAAGATCTCAGTTTCAACAAGAAGTGGAGGTATTGAGCTGCATTAGACATCCTAACATGGTTCTACTTCTTGGGGCTTGTCCAGAATGTGGATGTTTAGTCTACGAGTTCATGGCAAACGGAAGCTTAGAAGATCGTCTCTTCAGATTAGGAAACAGCCCGCCTCTGTCTTGGCAGATGAGGTTCAGAATCGCTGCAGAGATAGGCACTGGACTGTTGTTCTTGCACCAAGCTAAACCTGAGCCTCTGGTTCACCGTGATCTCAAACCGGGAAATATCTTGCTAGACCGTAACTTTGTCAGCAAGATTTCTGATGTTGGTTTGGCCAGGTTAGTGCCTCCATCAGTTGCAGACACGGTGACACAATACCGCATGACTTCAACAGCTGGCACGTTCTGCTACATCGACCCAGAGTATCAGCAAACAGGCATGTTGGGTGTGAAATCTGATATTTACTCGTTAGGGATTATGTTTCTGCAGTTAATAACAGCAAAACCACCAATGGGTCTCACTCATTACGTCGAGAGAGCACTCGAGAAAGGGACTTTGGCAGATTTGTTGGATCCTGCTGTTTCAGATTGGCCACTTGAAGATACCGCAGAGTTTGCCAAGTTAGCACTCAAATGCGCAGAGCTAAGGAGAAAAGACAGACCTGACCTAGCTAAAGTTATATTGCCTGAGCTAAACAGATTAAGAACACTTGCTGAAGAATCAACGCAGTCTGTACAATTCATCAATAGCCCTGGACCATCCCCAACCGGAAGCCAAAATTCCTTGAAACTGGAACAGTTGGGTGGTGCTTCTATCTCTGTGCCTCAGTGA


Protein sequences

Name Description Sequence
Thhalv10000051m protein obtained from Pythozome database for gene Thhalv10000051m

MWMAKNNNVGNKEGGGSSGVVAVAIDKDKSSQHALKWAVDHLLQRGQSVILVHVKLRPSPLTNSPSLHASSAKLSQDSSLVCRDPEGASKEIFLPFRCFCTRKDIQCQDVLLEEYDVAKALVEYANQAAIEVLVVGSSNKGGFLRFNKPTDIPGTIAKTAPDFCTVYVISKGKISTMRSASRSAPTTAPLRSPIQPPSLKPPQPVPSTSTNMRAERRSFESQQRRSMEEQQRRSMEDQQRRSMEDQQRRSMEDQSESFRSPFTRRGYGRSYGDLSVPESDISFVSSGRPSIDRIFPNIYDNNDPNRTPPRLSNFSDMDYSPSIDQSSNYGRRSVDISSPTDYSSGSFDSNERFSSASAMDDVESEMRRLKLELKQTIEMYSTACKEALTAKQKATELQRWKLEEERKLEEARLAEEAALAIAEKEKAKSKAAMEAAEAAQRIAELEAKKRVNAEMKALKESEEKTKALTALANSDVRYRKYSIEEIESATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQEVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAEIGTGLLFLHQAKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDIYSLGIMFLQLITAKPPMGLTHYVERALEKGTLADLLDPAVSDWPLEDTAEFAKLALKCAELRRKDRPDLAKVILPELNRLRTLAEESTQSVQFINSPGPSPTGSQNSLKLEQLGGASISVPQ*

Domains

Domain Start-End Description Sequence

Seg: seg
5-24 seg

KNNNVGNKEGGGSSGVVAVA

Gene3D: G3DSA:3.40.50.620
IPR014729
21-146 no description
Rossmann-like alpha/beta/alpha sandwich fold

VAVAIDKDKSSQHALKWAVDHLLQRGQSVILVHVKLRPSPLTNSPSLHASSAKLSQDSSLVCRDPEGASKEIFLPFRCFCTRKDIQCQDVLLEEYDVAKALVEYANQAAIEVLVVGSSNKGGFLRF

superfamily: SSF52402
21-146 Adenine nucleotide alpha hydrolases-like

VAVAIDKDKSSQHALKWAVDHLLQRGQSVILVHVKLRPSPLTNSPSLHASSAKLSQDSSLVCRDPEGASKEIFLPFRCFCTRKDIQCQDVLLEEYDVAKALVEYANQAAIEVLVVGSSNKGGFLRF

HMMPfam: PF00582
IPR006016
21-146 Usp
UspA

VAVAIDKDKSSQHALKWAVDHLLQRGQSVILVHVKLRPSPLTNSPSLHASSAKLSQDSSLVCRDPEGASKEIFLPFRCFCTRKDIQCQDVLLEEYDVAKALVEYANQAAIEVLVVGSSNKGGFLRF

HMMPanther: PTHR24420
172-786 FAMILY NOT NAMED,FAMILY NOT NAMED

GKISTMRSASRSAPTTAPLRSPIQPPSLKPPQPVPSTSTNMRAERRSFESQQRRSMEEQQRRSMEDQQRRSMEDQQRRSMEDQSESFRSPFTRRGYGRSYGDLSVPESDISFVSSGRPSIDRIFPNIYDNNDPNRTPPRLSNFSDMDYSPSIDQSSNYGRRSVDISSPTDYSSGSFDSNERFSSASAMDDVESEMRRLKLELKQTIEMYSTACKEALTAKQKATELQRWKLEEERKLEEARLAEEAALAIAEKEKAKSKAAMEAAEAAQRIAELEAKKRVNAEMKALKESEEKTKALTALANSDVRYRKYSIEEIESATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQEVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAEIGTGLLFLHQAKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDIYSLGIMFLQLITAKPPMGLTHYVERALEKGTLADLLDPAVSDWPLEDTAEFAKLALKCAELRRKDRPDLAKVILPELNRLRTLAEESTQSVQFINSPGPSPTGSQNS

HMMPanther: PTHR24420:SF203
172-786 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GKISTMRSASRSAPTTAPLRSPIQPPSLKPPQPVPSTSTNMRAERRSFESQQRRSMEEQQRRSMEDQQRRSMEDQQRRSMEDQSESFRSPFTRRGYGRSYGDLSVPESDISFVSSGRPSIDRIFPNIYDNNDPNRTPPRLSNFSDMDYSPSIDQSSNYGRRSVDISSPTDYSSGSFDSNERFSSASAMDDVESEMRRLKLELKQTIEMYSTACKEALTAKQKATELQRWKLEEERKLEEARLAEEAALAIAEKEKAKSKAAMEAAEAAQRIAELEAKKRVNAEMKALKESEEKTKALTALANSDVRYRKYSIEEIESATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQEVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAEIGTGLLFLHQAKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDIYSLGIMFLQLITAKPPMGLTHYVERALEKGTLADLLDPAVSDWPLEDTAEFAKLALKCAELRRKDRPDLAKVILPELNRLRTLAEESTQSVQFINSPGPSPTGSQNS

Seg: seg
192-207 seg

SPIQPPSLKPPQPVPS

Seg: seg
215-236 seg

ERRSFESQQRRSMEEQQRRSME

Coil: coil
359-380 coiled-coil

MDDVESEMRRLKLELKQTIEMY

Coil: coil
385-469 coiled-coil

KEALTAKQKATELQRWKLEEERKLEEARLAEEAALAIAEKEKAKSKAAMEAAEAAQRIAELEAKKRVNAEMKALKESEEKTKALT

Seg: seg
396-447 seg

ELQRWKLEEERKLEEARLAEEAALAIAEKEKAKSKAAMEAAEAAQRIAELEA

Gene3D: G3DSA:3.30.200.20
476-552 no description

VRYRKYSIEEIESATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQEVEVLSCIRHPNMVLLL

superfamily: SSF56112
IPR011009
479-753 Protein kinase-like (PK-like)
Protein kinase-like domain

RKYSIEEIESATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQEVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAEIGTGLLFLHQAKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDIYSLGIMFLQLITAKPPMGLTHYVERALEKGTLADLLDPAVSDWPLEDTAEFAKLALKCAELRRKDRPDLAKVIL

ProfileScan: PS50011
IPR000719
493-756 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQEVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAEIGTGLLFLHQAKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDIYSLGIMFLQLITAKPPMGLTHYVERALEKGTLADLLDPAVSDWPLEDTAEFAKLALKCAELRRKDRPDLAKVILPEL

HMMSmart: SM00220
IPR002290
493-756 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQEVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAEIGTGLLFLHQAKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDIYSLGIMFLQLITAKPPMGLTHYVERALEKGTLADLLDPAVSDWPLEDTAEFAKLALKCAELRRKDRPDLAKVILPEL

HMMSmart: SM00219
IPR020635
493-759 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQEVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAEIGTGLLFLHQAKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDIYSLGIMFLQLITAKPPMGLTHYVERALEKGTLADLLDPAVSDWPLEDTAEFAKLALKCAELRRKDRPDLAKVILPELNRL

HMMPfam: PF00069
IPR000719
496-751 Pkinase,Ser-thr
Protein kinase, catalytic domain

KYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQEVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAEIGTGLLFLHQAKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDIYSLGIMFLQLITAKPPMGLTHYVERALEKGTLADLLDPAVSDWPLEDTAEFAKLALKCAELRRKDRPDLAKV

Gene3D: G3DSA:1.10.510.10
553-751 no description

GACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAEIGTGLLFLHQAKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDIYSLGIMFLQLITAKPPMGLTHYVERALEKGTLADLLDPAVSDWPLEDTAEFAKLALKCAELRRKDRPDLAKV

PatternScan: PS00108
IPR008271
611-623 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

LVHRDLKPGNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox