PRGDB00218626 (Thhalv10000545m)

From PRG Wiki
Jump to: navigation, search
Thhalv10000545m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Eutrema halophilum

Comment?

DNA Sequence

CTCGACATCAGCGGTCGAGATCTCAGCGGCAAAATCTCCCCATCAATCGCAAATCTAACCGCTTTAATCGTTCTTGATCTGTCAAGAAACTTCTTCACAGGAGAAATACCATCTGAGATAGGCTCATTGCATAAAACCTTAAAGCAGTTAAGTCTCTCTGAGAATCTCTTACAAGAAAACATTCCACAAGAGCTTGGTTCGCTTAATCTTCTTGTTTATCTCGATCTCGGAACCAACCGGTTAACCGGTCAAATTCCGGTTCAGCTCTTTTGCAACGGTTCTTCTTCTTCTCTGCTATACATAGACCTCTCTAACAATTCTCTCAATGGAGAAATCCCTCTAAAGAACCATTGTCACCTTAAAGAACTTCGGTTTCTTCTTCTCTGTCGGTTCGAACCAGATGTAAAAGCGCCGCCGCGAAGGAGATTGGAAGACAAGGAGGCGTCGGAGAAGTCGAGGAGGAGAAGTAGAAGCGCCGACGCCACCAGGAAGGCGGAGAAGTCACGAGGACGGATGAGAGGCGACGGAAAGTCAAATCTGTTAACCGGAGAGTTACCTTCTCTAGTTATAAGCAATATGCCACAGCTTCAATTTCTTTACCTTTCTTATAACCATTTCGTTAGCCACAACAATAACACCGACCTCGAACCCTTTTTCGCCTCTCTCTCCAATTCTTCTGGCCTACAAGAGCTTGAGTTAGCCGGAAACAGTCTTGGAGGAGAGATAACTTCTTCCGTAAGGCACCTCTCTGTGAATCTTGTGCAGCTTCATCTTGATCAAAACCATATCCATGGCTCTATACCTCCAGAAATATCAAACCTTTTGAACCTAACCCTTTTAAACTTGTCGAGTAACCTTTTGACCGGTCCAATCCCCTGGGAGCTCTGTAAGCTAAGCAAACTTGAAAGGGTTTATCTTTTGAATTATCTCTTAACCGGTGAAATCCCAGTGGAACTAGGGGATATTCCTCATCTAGGTCTTCTTGATTTGTCTAGAAACAAGCTATCTGGTTCAATCCCGGATAGTTTTGCTAACCTTTCTCAGCTGAGAAGACTTATTCTGTATGGAAACCATCTCTCTGGTATGGTCCCTCAAAGCCTTGGCCAGTGTATCAATCTTGAGATTCTTGACCTATCTCACAACAACCTCTCAGGCAAGATTCCTGTTGAAGTTGTCTCCAATCTCAGAAACCTGAAGCTTTATCTTAACCTCTCAAGCAACCACTTAAATGGAGAAATTCCTTTGGAGCTAAGCAAAATGGATATGGATCTCTCCATTGATCTATCTTCCAACGAACTTTCAGGGAAAATTCCACCTCAGCTCGGAAATTGCATTGCATTGGAGCATCTGAATCTTTCAAGAAACGGTTTCTTTGGTCCACTTCCTGCTTCATTAGGCCAATTGCCATATCTAAAAGAGCTAGATTCTTCCACTCTCAAGCACTTGAATTTCTCCTTCAACCTGTTCTCCGGAAATGCATCTGACAAAGGATCATTCTCTAAGCTGAGTATTGATTTTTTTCTTGGGGATTCTTCCTTGTGTGGCTCTGTACAAGGGATGCAATCCTGCAAGAAGAAGCACAAGTACCCTGTTGTTCTTCTACCGGTTCTATTATCGTTGATTGTAACTCATGTTCTGTGTGTTTTCGGGTACCCTTTGGTCCAAAGATCAAAAATTGGAAAGAATCTAACAGTTTACGATGAAGAAGAGATGGAAGATGAAGAAAAACAGAACCGAAAAGACACGAAATACCCAAGAATATCATATCAGCAGCTCAATGAAGCAACAAGAGGTTTCAGTTCTTCTAGCCTAATTGGATCAGGGAGGTTTGGTCATGTGTACAAAGGAATTCTCAGAAACAACAAGAAGATTGCAGTGAAAGTACTCGATCCAAAGACTGCAGCAGAGTTCACAGGGAGCTTCAAAAGAGAATGTTTCAAGGCTATTGTTCTGCCATTAATGCCAAATGGGAGCTTGGAGAGGCATTTATACCCTGAGGAGTACTCAGGCAGGAGCTTGGATTTGATTCAGTTGGTGAGTATTTGCAGCGATGTCGCCGAAGGAATAGCTTACTTGCATGACTATTCACCTGTCAAAGTCGTTCACTGTGATCTCAAACCAAGCAATATTCTTCTTGACGATGAAATGACCGCTCTGGTTACAGATTTTGGAATTTCAAGATTGGTTCAAGGAGTCCAAGAAACGGTTGATTCAGTGTCATTTGGCTCAACAGATGGACTATTATGCGGATCAGTCGGTTACATTGCGCCAGAATATGGGATGGGGAAACGTGCATCTATCCATGGAGATGTGTACAGTTTTGGTGTTCTCCTGCTAGAGATTGTGAGCGGAAGGAGACCAACGGATGTTCTTGTCAACGAAGGATCAAGCTTGCATGAGTTTATGAAGTGGAATTACCAGAATTCTCTAGAGGGAATCATCGAACAAGCACTAATAAGATTAAAACCGCAAGGGAAGGCAGAGAGATGTGAGAAGCTATGGAGAGAAGTCATATTGGAAATGATTGAGTTGGGATTGATATGTACTCAATATACTCCTTCAACTAGGCCTAACATGCTTGATGTCGCACAAGAGATGGGAAGGCTTAAAGAGTTTCTATTTGCTTGTCCTTCTCTTCCAAGTTATCAACCTCAAGAAACAGAAGGAGAAGCTAGTTCATGA


Protein sequences

Name Description Sequence
Thhalv10000545m protein obtained from Pythozome database for gene Thhalv10000545m

LDISGRDLSGKISPSIANLTALIVLDLSRNFFTGEIPSEIGSLHKTLKQLSLSENLLQENIPQELGSLNLLVYLDLGTNRLTGQIPVQLFCNGSSSSLLYIDLSNNSLNGEIPLKNHCHLKELRFLLLCRFEPDVKAPPRRRLEDKEASEKSRRRSRSADATRKAEKSRGRMRGDGKSNLLTGELPSLVISNMPQLQFLYLSYNHFVSHNNNTDLEPFFASLSNSSGLQELELAGNSLGGEITSSVRHLSVNLVQLHLDQNHIHGSIPPEISNLLNLTLLNLSSNLLTGPIPWELCKLSKLERVYLLNYLLTGEIPVELGDIPHLGLLDLSRNKLSGSIPDSFANLSQLRRLILYGNHLSGMVPQSLGQCINLEILDLSHNNLSGKIPVEVVSNLRNLKLYLNLSSNHLNGEIPLELSKMDMDLSIDLSSNELSGKIPPQLGNCIALEHLNLSRNGFFGPLPASLGQLPYLKELDSSTLKHLNFSFNLFSGNASDKGSFSKLSIDFFLGDSSLCGSVQGMQSCKKKHKYPVVLLPVLLSLIVTHVLCVFGYPLVQRSKIGKNLTVYDEEEMEDEEKQNRKDTKYPRISYQQLNEATRGFSSSSLIGSGRFGHVYKGILRNNKKIAVKVLDPKTAAEFTGSFKRECFKAIVLPLMPNGSLERHLYPEEYSGRSLDLIQLVSICSDVAEGIAYLHDYSPVKVVHCDLKPSNILLDDEMTALVTDFGISRLVQGVQETVDSVSFGSTDGLLCGSVGYIAPEYGMGKRASIHGDVYSFGVLLLEIVSGRRPTDVLVNEGSSLHEFMKWNYQNSLEGIIEQALIRLKPQGKAERCEKLWREVILEMIELGLICTQYTPSTRPNMLDVAQEMGRLKEFLFACPSLPSYQPQETEGEASS*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF805
1-871 SUBFAMILY NOT NAMED

LDISGRDLSGKISPSIANLTALIVLDLSRNFFTGEIPSEIGSLHKTLKQLSLSENLLQENIPQELGSLNLLVYLDLGTNRLTGQIPVQLFCNGSSSSLLYIDLSNNSLNGEIPLKNHCHLKELRFLLLCRFEPDVKAPPRRRLEDKEASEKSRRRSRSADATRKAEKSRGRMRGDGKSNLLTGELPSLVISNMPQLQFLYLSYNHFVSHNNNTDLEPFFASLSNSSGLQELELAGNSLGGEITSSVRHLSVNLVQLHLDQNHIHGSIPPEISNLLNLTLLNLSSNLLTGPIPWELCKLSKLERVYLLNYLLTGEIPVELGDIPHLGLLDLSRNKLSGSIPDSFANLSQLRRLILYGNHLSGMVPQSLGQCINLEILDLSHNNLSGKIPVEVVSNLRNLKLYLNLSSNHLNGEIPLELSKMDMDLSIDLSSNELSGKIPPQLGNCIALEHLNLSRNGFFGPLPASLGQLPYLKELDSSTLKHLNFSFNLFSGNASDKGSFSKLSIDFFLGDSSLCGSVQGMQSCKKKHKYPVVLLPVLLSLIVTHVLCVFGYPLVQRSKIGKNLTVYDEEEMEDEEKQNRKDTKYPRISYQQLNEATRGFSSSSLIGSGRFGHVYKGILRNNKKIAVKVLDPKTAAEFTGSFKRECFKAIVLPLMPNGSLERHLYPEEYSGRSLDLIQLVSICSDVAEGIAYLHDYSPVKVVHCDLKPSNILLDDEMTALVTDFGISRLVQGVQETVDSVSFGSTDGLLCGSVGYIAPEYGMGKRASIHGDVYSFGVLLLEIVSGRRPTDVLVNEGSSLHEFMKWNYQNSLEGIIEQALIRLKPQGKAERCEKLWREVILEMIELGLICTQYTPSTRPNMLDVAQEMGRLKE

superfamily: SSF52047
1-283 RNI-like,LRR

LDISGRDLSGKISPSIANLTALIVLDLSRNFFTGEIPSEIGSLHKTLKQLSLSENLLQENIPQELGSLNLLVYLDLGTNRLTGQIPVQLFCNGSSSSLLYIDLSNNSLNGEIPLKNHCHLKELRFLLLCRFEPDVKAPPRRRLEDKEASEKSRRRSRSADATRKAEKSRGRMRGDGKSNLLTGELPSLVISNMPQLQFLYLSYNHFVSHNNNTDLEPFFASLSNSSGLQELELAGNSLGGEITSSVRHLSVNLVQLHLDQNHIHGSIPPEISNLLNLTLLNLS

Gene3D: G3DSA:3.80.10.10
1-125 no description

LDISGRDLSGKISPSIANLTALIVLDLSRNFFTGEIPSEIGSLHKTLKQLSLSENLLQENIPQELGSLNLLVYLDLGTNRLTGQIPVQLFCNGSSSSLLYIDLSNNSLNGEIPLKNHCHLKELRF

HMMPanther: PTHR24420
1-871 FAMILY NOT NAMED,FAMILY NOT NAMED

LDISGRDLSGKISPSIANLTALIVLDLSRNFFTGEIPSEIGSLHKTLKQLSLSENLLQENIPQELGSLNLLVYLDLGTNRLTGQIPVQLFCNGSSSSLLYIDLSNNSLNGEIPLKNHCHLKELRFLLLCRFEPDVKAPPRRRLEDKEASEKSRRRSRSADATRKAEKSRGRMRGDGKSNLLTGELPSLVISNMPQLQFLYLSYNHFVSHNNNTDLEPFFASLSNSSGLQELELAGNSLGGEITSSVRHLSVNLVQLHLDQNHIHGSIPPEISNLLNLTLLNLSSNLLTGPIPWELCKLSKLERVYLLNYLLTGEIPVELGDIPHLGLLDLSRNKLSGSIPDSFANLSQLRRLILYGNHLSGMVPQSLGQCINLEILDLSHNNLSGKIPVEVVSNLRNLKLYLNLSSNHLNGEIPLELSKMDMDLSIDLSSNELSGKIPPQLGNCIALEHLNLSRNGFFGPLPASLGQLPYLKELDSSTLKHLNFSFNLFSGNASDKGSFSKLSIDFFLGDSSLCGSVQGMQSCKKKHKYPVVLLPVLLSLIVTHVLCVFGYPLVQRSKIGKNLTVYDEEEMEDEEKQNRKDTKYPRISYQQLNEATRGFSSSSLIGSGRFGHVYKGILRNNKKIAVKVLDPKTAAEFTGSFKRECFKAIVLPLMPNGSLERHLYPEEYSGRSLDLIQLVSICSDVAEGIAYLHDYSPVKVVHCDLKPSNILLDDEMTALVTDFGISRLVQGVQETVDSVSFGSTDGLLCGSVGYIAPEYGMGKRASIHGDVYSFGVLLLEIVSGRRPTDVLVNEGSSLHEFMKWNYQNSLEGIIEQALIRLKPQGKAERCEKLWREVILEMIELGLICTQYTPSTRPNMLDVAQEMGRLKE

HMMSmart: SM00369
IPR003591
19-43 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTALIVLDLSRNFFTGEIPSEIGSL

ProfileScan: PS51450
IPR001611
21-43 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALIVLDLSRNFFTGEIPSEIGSL

HMMPfam: PF00560
IPR001611
22-43 LRR_1
Leucine-rich repeat

LIVLDLSRNFFTGEIPSEIGSL

ProfileScan: PS51450
IPR001611
46-69 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLKQLSLSENLLQENIPQELGSLN

HMMSmart: SM00369
IPR003591
68-92 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LNLLVYLDLGTNRLTGQIPVQLFCN

ProfileScan: PS51450
IPR001611
70-92 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLVYLDLGTNRLTGQIPVQLFCN

ProfileScan: PS51450
IPR001611
97-119 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLLYIDLSNNSLNGEIPLKNHCH

Seg: seg
144-165 seg

EDKEASEKSRRRSRSADATRKA

Gene3D: G3DSA:3.80.10.10
177-300 no description

KSNLLTGELPSLVISNMPQLQFLYLSYNHFVSHNNNTDLEPFFASLSNSSGLQELELAGNSLGGEITSSVRHLSVNLVQLHLDQNHIHGSIPPEISNLLNLTLLNLSSNLLTGPIPWELCKLSK

HMMSmart: SM00369
IPR003591
193-221 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MPQLQFLYLSYNHFVSHNNNTDLEPFFAS

ProfileScan: PS51450
IPR001611
195-216 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLQFLYLSYNHFVSHNNNTDLE

superfamily: SSF52047
217-490 RNI-like,LRR

PFFASLSNSSGLQELELAGNSLGGEITSSVRHLSVNLVQLHLDQNHIHGSIPPEISNLLNLTLLNLSSNLLTGPIPWELCKLSKLERVYLLNYLLTGEIPVELGDIPHLGLLDLSRNKLSGSIPDSFANLSQLRRLILYGNHLSGMVPQSLGQCINLEILDLSHNNLSGKIPVEVVSNLRNLKLYLNLSSNHLNGEIPLELSKMDMDLSIDLSSNELSGKIPPQLGNCIALEHLNLSRNGFFGPLPASLGQLPYLKELDSSTLKHLNFSFNLFS

ProfileScan: PS51450
IPR001611
227-249 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLQELELAGNSLGGEITSSVRHL

ProfileScan: PS51450
IPR001611
252-274 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVQLHLDQNHIHGSIPPEISNL

Seg: seg
272-288 seg

SNLLNLTLLNLSSNLLT

ProfileScan: PS51450
IPR001611
276-297 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTLLNLSSNLLTGPIPWELCK

Gene3D: G3DSA:3.80.10.10
301-501 no description

LERVYLLNYLLTGEIPVELGDIPHLGLLDLSRNKLSGSIPDSFANLSQLRRLILYGNHLSGMVPQSLGQCINLEILDLSHNNLSGKIPVEVVSNLRNLKLYLNLSSNHLNGEIPLELSKMDMDLSIDLSSNELSGKIPPQLGNCIALEHLNLSRNGFFGPLPASLGQLPYLKELDSSTLKHLNFSFNLFSGNASDKGSFSK

HMMSmart: SM00369
IPR003591
322-345 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

IPHLGLLDLSRNKLSGSIPDSFAN

HMMPfam: PF13855
323-383 LRR_8,Leucine rich repeat

PHLGLLDLSRNKLSGSIPDSFANLSQLRRLILYGNHLSGMVPQSLGQCINLEILDLSHNNL

ProfileScan: PS51450
IPR001611
324-346 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLGLLDLSRNKLSGSIPDSFANL

HMMSmart: SM00369
IPR003591
346-369 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSQLRRLILYGNHLSGMVPQSLGQ

ProfileScan: PS51450
IPR001611
348-369 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLRRLILYGNHLSGMVPQSLGQ

HMMSmart: SM00369
IPR003591
370-394 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

CINLEILDLSHNNLSGKIPVEVVSN

ProfileScan: PS51450
IPR001611
372-394 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEILDLSHNNLSGKIPVEVVSN

HMMSmart: SM00369
IPR003591
395-420 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRNLKLYLNLSSNHLNGEIPLELSKM

ProfileScan: PS51450
IPR001611
397-419 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKLYLNLSSNHLNGEIPLELSK

HMMPfam: PF00560
IPR001611
447-468 LRR_1
Leucine-rich repeat

LEHLNLSRNGFFGPLPASLGQL

Seg: seg
530-542 seg

PVVLLPVLLSLIV

Seg: seg
567-575 seg

DEEEMEDEE

Gene3D: G3DSA:3.30.200.20
579-645 no description

RKDTKYPRISYQQLNEATRGFSSSSLIGSGRFGHVYKGILRNNKKIAVKVLDPKTAAEFTGSFKREC

superfamily: SSF56112
IPR011009
584-886 Protein kinase-like (PK-like)
Protein kinase-like domain

YPRISYQQLNEATRGFSSSSLIGSGRFGHVYKGILRNNKKIAVKVLDPKTAAEFTGSFKRECFKAIVLPLMPNGSLERHLYPEEYSGRSLDLIQLVSICSDVAEGIAYLHDYSPVKVVHCDLKPSNILLDDEMTALVTDFGISRLVQGVQETVDSVSFGSTDGLLCGSVGYIAPEYGMGKRASIHGDVYSFGVLLLEIVSGRRPTDVLVNEGSSLHEFMKWNYQNSLEGIIEQALIRLKPQGKAERCEKLWREVILEMIELGLICTQYTPSTRPNMLDVAQEMGRLKEFLFACPSLPSYQPQE

HMMSmart: SM00220
IPR002290
599-873 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSSSSLIGSGRFGHVYKGILRNNKKIAVKVLDPKTAAEFTGSFKRECFKAIVLPLMPNGSLERHLYPEEYSGRSLDLIQLVSICSDVAEGIAYLHDYSPVKVVHCDLKPSNILLDDEMTALVTDFGISRLVQGVQETVDSVSFGSTDGLLCGSVGYIAPEYGMGKRASIHGDVYSFGVLLLEIVSGRRPTDVLVNEGSSLHEFMKWNYQNSLEGIIEQALIRLKPQGKAERCEKLWREVILEMIELGLICTQYTPSTRPNMLDVAQEMGRLKEFL

HMMSmart: SM00219
IPR020635
599-866 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSSSSLIGSGRFGHVYKGILRNNKKIAVKVLDPKTAAEFTGSFKRECFKAIVLPLMPNGSLERHLYPEEYSGRSLDLIQLVSICSDVAEGIAYLHDYSPVKVVHCDLKPSNILLDDEMTALVTDFGISRLVQGVQETVDSVSFGSTDGLLCGSVGYIAPEYGMGKRASIHGDVYSFGVLLLEIVSGRRPTDVLVNEGSSLHEFMKWNYQNSLEGIIEQALIRLKPQGKAERCEKLWREVILEMIELGLICTQYTPSTRPNMLDVAQEM

ProfileScan: PS50011
IPR000719
599-873 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSSSLIGSGRFGHVYKGILRNNKKIAVKVLDPKTAAEFTGSFKRECFKAIVLPLMPNGSLERHLYPEEYSGRSLDLIQLVSICSDVAEGIAYLHDYSPVKVVHCDLKPSNILLDDEMTALVTDFGISRLVQGVQETVDSVSFGSTDGLLCGSVGYIAPEYGMGKRASIHGDVYSFGVLLLEIVSGRRPTDVLVNEGSSLHEFMKWNYQNSLEGIIEQALIRLKPQGKAERCEKLWREVILEMIELGLICTQYTPSTRPNMLDVAQEMGRLKEFL

PatternScan: PS00107
IPR017441
605-627 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGRFGHVYKGILRNNKKIAVK

HMMPfam: PF00069
IPR000719
637-862 Pkinase,Ser-thr
Protein kinase, catalytic domain

FTGSFKRECFKAIVLPLMPNGSLERHLYPEEYSGRSLDLIQLVSICSDVAEGIAYLHDYSPVKVVHCDLKPSNILLDDEMTALVTDFGISRLVQGVQETVDSVSFGSTDGLLCGSVGYIAPEYGMGKRASIHGDVYSFGVLLLEIVSGRRPTDVLVNEGSSLHEFMKWNYQNSLEGIIEQALIRLKPQGKAERCEKLWREVILEMIELGLICTQYTPSTRPNMLDV

Gene3D: G3DSA:1.10.510.10
654-866 no description

MPNGSLERHLYPEEYSGRSLDLIQLVSICSDVAEGIAYLHDYSPVKVVHCDLKPSNILLDDEMTALVTDFGISRLVQGVQETVDSVSFGSTDGLLCGSVGYIAPEYGMGKRASIHGDVYSFGVLLLEIVSGRRPTDVLVNEGSSLHEFMKWNYQNSLEGIIEQALIRLKPQGKAERCEKLWREVILEMIELGLICTQYTPSTRPNMLDVAQEM

PatternScan: PS00108
IPR008271
700-712 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHCDLKPSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox