PRGWA00000001 (AVR-Pik)

From PRG Wiki
Jump to: navigation, search


AVR-Pik
Author User:Felice
Gene Type Contributed Avirulence Genes
GenBank ID BAH59486.1
GenBank Locus BAH59486
Organism Species:Magnaporthe oryzae
Approved Yes



Protein Sequences

  • Name: AVR-Pik [Magnaporthe oryzae]

MRVTTFNTFLLTLGTVAVVNAETGNKYIEKRAIDLSRERDPNFFDHPGIPVPECFWFMFKNNVRQDAGTCYSSWKMDMKVGPNWVHIKSDDNCNLSGDFPPGWIVLGKKRPGF


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox