PRGWK00000001 (MELO3C000062)

From PRG Wiki
Jump to: navigation, search


MELO3C000062
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:CN
Location contig31164
Location Start 219
Organism Species:Cucumis melo
Approved true



CDS Sequence

ATGGACATCCTTATTTCAGTCATTGCAAAAATTGCTGAATACACTGTTGAGCCTGTTGGACGCCAACTTGGTTATGTATTTTTCATTCGTTCCAACTTTCAAAAACTTAAGACTCAAGTAGAAAAGCTGAAGATTACAAGAGAGTCTGTGCAACACAAGATCCATAGTGCAAGAAGAAATGCTGAAGACATAAAACCTGCCGTTGAGGAATGGTTGAAAAAGGTCGATGACTTTGTTCGAGAATCTGACGAGATATTAGCCAATGAAGGTGGACATGGTGGACTCTGTTCCACCTATTTCGTCCAACGACACAAGTTAAGTAGAAAAGCAAGCAAAATGGTAGATGAGGTTCTTGAGATGAAAAATGAGGGGGAAAGTTTTGATATGGTATCCTATAAAAGTGTTATCCCATCAGTTGATTGTTCACTTCCAAAAGTGCCTGACTTTCTTGACTTTGAGTCAAGAAAGTCGATTATGGAACAAATCATGGATGCACTATCTGATGGTAATGTCCATAGGATTGGAGTATATGGGATGGGGGGTGTTGGCAAAACAATGCTAGTGAAGGATATTTTAAGAAAAATTGTGGAGAGTAAGAAGCCTTTTGATGAAGTG


Protein Sequences

MDILISVIAKIAEYTVEPVGRQLGYVFFIRSNFQKLKTQVEKLKITRESVQHKIHSARRNAEDIKPAVEEWLKKVDDFVRESDEILANEGGHGGLCSTYFVQRHKLSRKASKMVDEVLEMKNEGESFDMVSYKSVIPSVDCSLPKVPDFLDFESRKSIMEQIMDALSDGNVHRIGVYGMGGVGKTMLVKDILRKIVESKKPFDEV


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox