PRGWK00000004 (MELO3C000335)

From PRG Wiki
Jump to: navigation, search


MELO3C000335
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:RLP
Location contig32711
Location Start 93
Organism Species:Cucumis melo
Approved true



CDS Sequence

ATGACAAATCTAAGAGTATTGAAATTGAACAATGTTCATCTTTGTGAAGAAATTGAATATCTCTCTGATCAACTAAGGTTTCTCAATTGGCATGGTTACCCTTTAAAGACCTTACCATCAAATTTCAATCCCACAAATCTATTGGAGCTTGAGTTGCCAAATAGCTCTATTCACCTTCTTTGGACTACTTCAAAGAGCATGGAAACATTGAAAGTTATAAACCTAAGTGATTCTCAATTCCTATCAAAGACACCTGATTTTTCAGTTGTTCCAAATCTTGAAAGATTGGTTTTAAGTGGCTGTGTAGAACTTCACCAACTTCACCACTCTTTGGGTAATCTAAAGCATCTAATTCAATTGGACCTTAGAAATTGCAAGAAATTAACAAACATTCCTTTCAATATTTGTTTAGAATCTCTCAAAATTTTGGTTCTTTCAGGCTGTTCCAGTCTCACCCATTTCCCAAAAATCTCATCAAACATGAACTATTTATTAGAGCTTCATTTAGAGGAAACATCCATAAAAGTTTTGCACTCATCAATAGGACATTTAACATCACTTGTTGTATTAAATCTCAAAAATTGCACAAATCTTCTAAAACTTCCTTCCACTATTGGCTCTTTAACATCTCTCAAAACCCTCAATTTAAATGGCTGCTCAGAACTTGATAGTCTTCCAGAGAGTTTAGGAAATATTTCTTCCTTAGAGAAGCTTGATATTACAAGCACTTGT


Protein Sequences

MTNLRVLKLNNVHLCEEIEYLSDQLRFLNWHGYPLKTLPSNFNPTNLLELELPNSSIHLLWTTSKSMETLKVINLSDSQFLSKTPDFSVVPNLERLVLSGCVELHQLHHSLGNLKHLIQLDLRNCKKLTNIPFNICLESLKILVLSGCSSLTHFPKISSNMNYLLELHLEETSIKVLHSSIGHLTSLVVLNLKNCTNLLKLPSTIGSLTSLKTLNLNGCSELDSLPESLGNISSLEKLDITSTC


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox