PRGWK00000007 (MELO3C002280)

From PRG Wiki
Jump to: navigation, search


MELO3C002280
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:RLP
Location scaffold00001
Location Start 2407900
Organism Species:Cucumis melo
Approved true



CDS Sequence

TATTAAATAGGACATTGTCTCTTAATAACATTTTCTCTTTCTTTTGGAGGGTTTTTCTAGTGTGTTGCAGAATAGATTTCCCTGTTGTTTACAATCATTGATGACATTTATTTAAATGCATCACTGTAACTCCTAATGATCTCCCAAGGGCTAACTAAAAGCCACAGATTATATGTCTTTTTTTTTTCTTTCCCAACTTCTCACCATCCCTTTCGTTTTCCTGCCTTCTATAACTACAAATAGAACCAGTTACCAGAGCTGGAATGCTAATTGCTTCATGTCTTTTATATGATTATTCCAGCTGAAACATGGCTGGCATTTACACGCTGCGGTTCCATCTCTTTTTCTTCATTCTCAGCGTTCTCCTTGCCGTGGCTCGAGGACAGACTCCAACAGATTCTGACTGGCTTCTGAAAATTAAATCAGAACTGGTTGATCCTGTTGGAGTCCTTGAAAACTGGTCTCCAAGTGTTCATGTATGTAGCTGGCATGGCATTTCATGTTCAAATGATGAGTCCCAAATTGTTAGTTTAAATCTTTCTCAGTCTAGATTATCAGGTTCCATGTGGAGTGAGTTATGGCATGTCACTTCACTTGAAGTGTTAGATTTGTCTTCAAACTCCCTCTCTGGTTCCATACCTTCTGAGTTGGGTCAGCTTTACAATCTAAGGGTACTGATCTTGCATTCAAATTTCCTGTCTGGAAAGCTTCCCACTGAGATAGGGCTTTTGAAGAACTTGCAAGCTCTCAGAATAGGTAACAACTTGTTATCAGGTGAAATCACACCATTTATTGGAAACTTGACTAATTTGACTGTTCTGGGTCTTGGCTATTGTGAATTCAATGGAAGTATTCCAGTTGAGATTGGTAACTTGAAGCATCTGATATCTCTTAATTTGCAGCAGAACAGACTCAGTGGTTCTATTCCCGACACCATTCGCGGAAACGAAGAGCTTGAAGACTTGTTGGTATCGAATAATATGTTGGATGGCAACGTTCCTGATTCATTAGGCTCCATAAAGTCATTGAGAGTTTTGAATTTGGCCAACAACAGCCTTTCTGGGTCAATTCCTGTTGCACTTAGTGGTCTTTCCAATTTGGTGTACTTGAACTTGCTTGGAAATAGGTTCAGTGGAGAAATACCTTCTGAGATAAATCAGTTGGTTCTTCTTGAGGAAGTAGATTTATCAAGAAACAACCTTTCAGGAACCATAAGCCTATTGAATACACAGCTGCAGAATCTTGTAACTCTGGTGTTATCAGATAATGCTTTAACAGGTAATATTCCAAACAGCTTCTGCTTCAAAACTTCAAATCTTCAACAATTATTTCTTGCCAGAAACAAGCTATCTGGCAAGTTCCCACAGGAGTTGCTCAACTGTTCCTCACTACAACAGTTGGATCTTTCTGGTAACAGGCTTGAAGGAGATCTTCCGTCTGGTCTGGACGATCTCAAGTGCCTAACAGTTCTTTTACTCAACAACAACAGCTTCACTGGATTTATACCTCCTCAAATTGGGAACATGAGCAACTTGGAGGACCTGTATTTGTTTGACAACAAGCTCACAGGGACTATTCCAAAGGAGATAGGGAAGCTAAAGAAGTTAAGTTTCATTTTCCTCTATGATAACCAGATGACAGGAAGCATTCCAAACGAGCTTACAAACTGCACGAACTTGATGGAGATTGATTTCTTTGGTAATCATTTTATAGGGCCCATTCCTGAGAATATTGGGAACCTGAAGAACCTGGCTGTGCTTCATCTAAGGCAAAACTTCTTGTGGGGTCCCATCCCAGCAAGTTTGGGCTATTGCAAAAGCCTTCAGTTGTTGGCTTTGGCTGACAACAATCTATCAGGATCATTGCCTTCCACTTTAGGTCTCCTCTCAGAATTGAGCACCATTACTCTATATAACAACTCTCTTGAAGGCCCTTTTCCTGTATCATTCTCCATTCTCAAACGTCTAAAGATAATAAACTTCTCCAATAATAAGTTTAATGGAACCATTCTTCCTCTCTGTGGCTTGAATTCCCTAACCGCATTGGATTTGACAAACAACAGTTTTTCAGGTCCTATTCCTTCTAGATTAATCAATTCCAGAAACTTGAGGCGTCTTCGCCTCGCACACAACAGACTCACTGGTTATATTCCCTCTGAATTCGGCCAATTGAAAGAGCTAAACTTCCTTGATTTATCACACAACAATCTCACAGGAGAAATGTCACCTCAACTCTTCAACTGTACCAAGCTTGAACACTTTCTGCTTAATGACAACAGACTGACGGGAACCATCACTCCACTGATAGGCAACTTACAGGCGGTTGGCGAGCTCGATTTCTCGTCCAACAGCTTGTACGGGAGAATACCTGCAGAAATTGGAAGCTGTTCTAAATTACTTAAGCTCTCTCTCCATAACAACAATCTATCAGGAATGATTCCACTGGAAATTGGAAATTTCACCTTCCTCAATGTTCTTAACCTGCAAAGAAACAACCTTTCAGGCTCCATTCCGTCAACGATCGAAAAGTGCAGCAAACTGTATGAGCTGAAACTATCTGAAAACTTCTTGACAGGTGAGATCCCTCAAGAGCTTGGAAAGCTGAGTGATTTACAAGTAGCACTGGATTTAAGCAGAAATCTTATATCTGGTGAAATCCCATCATCCATTGGAAATCTAATGAAGCTGGAAAGATTGGATCTCTCTTCAAATCATCTCACCGGTGAAATCCCGACTTCACTTGAACAACTGACAAGCATACATATCCTGAATCTGTCAGATAATCAACTACAAGGATCAATCCCTCGATTCTTTTCAGAGTTTCCATTAACCTCATTTAAGGGTAATGATGAACTCTGTGGCCGACCTCTATCATCATGTTCAAAATCTGCAAGCCAAGAGACAAGCAGATTATCCAAGGGTGCAGTGATAGGCATTATTGTGGCCATTGTTTTTACCTCCATGGTTATATGTCTAATAATGCTGTATACTATGCTGAGAATCTGGTGCAATTGGAAAAAGGTTTCTGTAGTTTCGAGCTCTGATGGAAGTGGGAATGAACATGGCAGAGAAGAGGTGAAATGGGTTTATAGAAATGACAAGAATGTAGGTCAGTACTGGAAAGTTGATTCTGTGGCATTCTAA


Protein Sequences

MAGIYTLRFHLFFFILSVLLAVARGQTPTDSDWLLKIKSELVDPVGVLENWSPSVHVCSWHGISCSNDESQIVSLNLSQSRLSGSMWSELWHVTSLEVLDLSSNSLSGSIPSELGQLYNLRVLILHSNFLSGKLPTEIGLLKNLQALRIGNNLLSGEITPFIGNLTNLTVLGLGYCEFNGSIPVEIGNLKHLISLNLQQNRLSGSIPDTIRGNEELEDLLVSNNMLDGNVPDSLGSIKSLRVLNLANNSLSGSIPVALSGLSNLVYLNLLGNRFSGEIPSEINQLVLLEEVDLSRNNLSGTISLLNTQLQNLVTLVLSDNALTGNIPNSFCFKTSNLQQLFLARNKLSGKFPQELLNCSSLQQLDLSGNRLEGDLPSGLDDLKCLTVLLLNNNSFTGFIPPQIGNMSNLEDLYLFDNKLTGTIPKEIGKLKKLSFIFLYDNQMTGSIPNELTNCTNLMEIDFFGNHFIGPIPENIGNLKNLAVLHLRQNFLWGPIPASLGYCKSLQLLALADNNLSGSLPSTLGLLSELSTITLYNNSLEGPFPVSFSILKRLKIINFSNNKFNGTILPLCGLNSLTALDLTNNSFSGPIPSRLINSRNLRRLRLAHNRLTGYIPSEFGQLKELNFLDLSHNNLTGEMSPQLFNCTKLEHFLLNDNRLTGTITPLIGNLQAVGELDFSSNSLYGRIPAEIGSCSKLLKLSLHNNNLSGMIPLEIGNFTFLNVLNLQRNNLSGSIPSTIEKCSKLYELKLSENFLTGEIPQELGKLSDLQVALDLSRNLISGEIPSSIGNLMKLERLDLSSNHLTGEIPTSLEQLTSIHILNLSDNQLQGSIPRFFSEFPLTSFKGNDELCGRPLSSCSKSASQETSRLSKGAVIGIIVAIVFTSMVICLIMLYTMLRIWCNWKKVSVVSSSDGSGNEHGREEVKWVYRNDKNVGQYWKVDSVAF


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox