PRGWK00000021 (MELO3C002574)

From PRG Wiki
Jump to: navigation, search


MELO3C002574
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:TIR
Location scaffold00001
Location Start 4478542
Organism Species:Cucumis melo
Approved true



CDS Sequence

ATGCAACGTTATTTTTCAACTGTGGCCAAAAACTACCTAACTTCCTCGTCCAAAATCCTCAGTCGTCGCAACGATATCCGATCCTTATCGCGCCAATGTGATGTCTTCATAAACCACCGTGGCGTCGACACGAAACGTAACATCGCCGGATTGCTTCATGACCATTTTTCTAGAATAGGTCTTCGCCCATTTTTAGATAGTAAGAGCATGAAACCGGGGGATAAATTGTTTGGTGAGATTGAAGAAGGTATTCGGAGTTGTAAGGTAGGACTCGCGGTGTTCTCACCACGGTATTGTGAATCCTATTTTTGTTTGCATGAACTTGCCCTAATGGTGGAGAACAAAAAGAAAATCATTCCAATTTTCGTGGACGTTCGACCGTCTCAACTTCGTGTTGAATACAACTATAGTTGCCCCAAGAAAGAGTTGCAAAGGTTCAACTGGGCACTTGGGGAAGCCAAATACACTGTTGGACTCACTTTCGACACTGTCAACGGGGATTGGTCGGAGCTGTTGAGGAAAGCTTCAAACGCCGTGATTGATAATCTAATCGTCGGCGAAGGGGCCGGAGAGATGCCGGATAATTAG


Protein Sequences

MQRYFSTVAKNYLTSSSKILSRRNDIRSLSRQCDVFINHRGVDTKRNIAGLLHDHFSRIGLRPFLDSKSMKPGDKLFGEIEEGIRSCKVGLAVFSPRYCESYFCLHELALMVENKKKIIPIFVDVRPSQLRVEYNYSCPKKELQRFNWALGEAKYTVGLTFDTVNGDWSELLRKASNAVIDNLIVGEGAGEMPDN


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox