PRGWK00000022 (MELO3C002627)

From PRG Wiki
Jump to: navigation, search


MELO3C002627
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:RLK
Location scaffold00001
Location Start 4979254
Organism Species:Cucumis melo
Approved true



CDS Sequence

GCAGAGGAGGGGCTCCGAAACAAAGCTCTCATCCTTCCTTCTTCCTTGAAAACTCCTATTCTCCTCTTTTCCCTTTTCCCCCTTTTCCCCTTCATATATTCATCTTCATCCTCAAAAACCTAAACCCTTTCATTTCCATTTCCACTCACAGAGAAGCACCAACAATGCTTCTCCACCCACTTTTTCTTCTCTTCTTCTTCTTCACCTTCTTCTCAAACCCTTCTCTTCTTTCCTTCTCTCTATCCCAAGAAGGCCTCTATCTCCACACCATCAAGCTTTCTCTCGACGACCCAGATTCTGCTCTCCGCTCATGGAACGACCGCGACGATACTCCCTGTTCCTGGTTCGGCGTCTCTTGCGACCCACAAACCAACTCCGTCCACTCTCTCGACCTTTCCAACACTAACATCGCCGGCCCATTTCCTTCCCTACTTTGCCGCCTCCAGAATCTTTCATTCCTCTCCCTTTACAACAATTCCATCAACATGTCCCTTCCCTCTGTTATTTCAAACTGTACCAGTCTCCACCATCTCGACCTCTCTCAGAATCTCCTCACCGGCGAGCTTCCGGCCTCGATTTCTGATCTCCCCAACCTTCGTTACTTGGATTTGACTGGGAATAACTTCTCCGGCGACATTCCGGAGAGTTTCGCTCGGTTTCAGAAGTTGGAAGTTCTGTCACTTGTTTATAACCTTCTCGATGGGCCTATGCCGGCGTTTCTCGGCAACATTACGTCGTTGAAGATGTTGAACCTGTCTTATAACCCTTTTGAGCCGAGTCGGATCCCGCCGGAGTTTGGGAATTTGATGAATCTTGAGGTGCTCTGGCTGACTCAGTGTAATTTGGTTGGGGAAATTCCGGAGTCTCTCGGTCGGTTGAAGCGGCTTACTGATTTGGACTTGGCGTTGAATAATCTTGACGGATCGATTCCGGAGTCGCTCATGGAGTTGAGTAGTGTGGTTCAGATTGAGTTGTATAATAACTCGTTAACGGGAGAGTTGCCTTCTGGGTTTTCGAAACTGACTTCATTGCGACTGTTTGACGCTTCGATGAATGGTTTGACTGGGGAGATTCCGGATGAGCTGTGTCAATTGCCTCTTGAGAGTCTTAATCTCTACGAGAACAAGTTTGAAGGGAAGTTACCGGAAAGCATTGCCAACTCCCCGGGTCTGTACGAACTCAGACTGTTCGGTAACCGGCTCACCGGTGAGTTACCGTCAAATCTTGGAAAGAACTCGCCAATGAGATGGATTGATGTTTCTAACAACCAGTTTACGGGTAAAATTCCGGGGAATTTATGTGAAAAGGGTGAGTTGGAGGAGCTTCTAATGATCAATAACCAATTTTCCGGCGAGATTCCGGCGAGTTTAGGTTCGTGCGAGAGTCTTACGAGGGTGCGATTGGGTTATAATCAATTTTCCGGCGAAGTACCGGCGGGATTTTGGGGTCTCCCACATGTTTATCTGTTAGAGCTGGTGAGCAACTCGTTTTCTGGGAAGATTTCAGATGCCATTGCCACTGCTAAGAACCTTTCCATTTTCATTATCTCTAAGAACAACTTCACCGGCATGTTACCGGCGGAGATGGGCCGGCTAGAAAACCTTGTGAAGTTGCTAGCAACAGATAACAAACTCAATGGATCATTACCTGAGAGTCTTGCGAATCTTAGGCATCTGTCGAGTTTGGATCTTCGGAATAATAAACTCTCTGGGGAACTTCCTAGTGGAATCAAGTCATGGAAGAATCTCAACGAACTCAATTTAGCTAACAATGAATTCACCGGCGAAATCCCTGAAGAAATCGGAAATTTGCCTGTTCTTAATTACTTAGATCTGTCTGGGAATCTGTTTTATGGGGATGTCCCTCTTGGGTTACAAAATTTGAAGCTCAATCTACTCAATTTATCGAACAATCACTTGTCTGGTGAGCTTCCTCCATTTTTAGCCAAGGAAATCTACAAAAATAGCTTTTTAGGAAATCCAGATTTGTGTGGACATTTTGAAAGTTTGTGCAATAGCAAAGCTGAAGCTAAAAGCCAAGGCTCTCTCTGGTTACTCCGTTCGATCTTCGTCCTTGCTGGTTTCGTGTTTATCGTAGGCGTCATCTGGTTTTATCTCAAATACAGGAAGTTTAAAATGGCAAAGAGAGAAATAGAGAAGAGTAAATGGACATTGATGTCCTTCCACAAGTTGGATTTCAGTGAATATGAGATCTTGGATTGTCTTGATGATGATAACATCATAGGCAGTGGATCTTCTGGTAAAGTTTACAAAGTTGTGCTCAACAATGGTGAGGCTGTTGCAGTGAAGAAGCTGTTTGGAGGATTGAGGAAAGAAGGTGAGAAGGGCGATATCGAGAAAGGTCAAGTTCAAGACAATGCCTTTGAAGCCGAAATTGATACTTTGGGAAAGATTAGGCACAAGAACATCGTGAAATTGTGGTGCTGTTGTGTTACAAGAGACTACAAGCTTTTAGTCTATGAATATATGCCTAATGGAAGCTTGGGAGATTTGCTTCATAGTAGTAAAAAAGGACTGCTTGATTGGCCTACGAGATTTAAGATAGCTTTAGATGCTGCAGAAGGACTTTCTTATCTTCATCACGATTGCGTCCCTCCGATCGTTCATCGAGACGTTAAGTCAAACAATATCTTGTTGGATGGCGATTTTGGAGCACGGTTAGCTGATTTTGGTGTAGCTAAAGTCATTGATTCAACTGGAAAAGGGCCTAAATCCATGTCCGTTATCGCAGGATCTTGTGGTTACATCGCTCCTGAGTATGCTTATACACTCCGAGTGAACGAAAAAAGCGACATATACAGTTTTGGTGTGGTGATTCTCGAGTTAATAACCGGGAGGCTTCCGGTTGATCCAGAATTCGGGGAGAAGGACTTGGTGAAATGGGTGTGTTACACATTGGATCAAGACGGGATCGATCAAGTTATCGACCGGAAACTGGATAGCTGTTACAAAGAAGAAATATGCAGAGTCCTTAACATTGGGTTGCTATGCACCAGCCCTCTACCAATCAACCGTCCATCCATGCGAAAAGTGGTGAAAATGCTACAAGAAGTAGGGGCAGAGAACCAATTGAAAAGCAGCAGTAAAGATGGAAAGTTAACTCCTTACTATTATGAAGATGCATCAGATCAGGGAAGTGTAGCTTAGAACCAAAAAATGGTTAAAAAACAGATCAGTTTGATTGCATAAAAGAAGAAATGTTTGAGTTTATACAAAAATTTTCTTTTCCCATATTCGCGCTGGTTTGGTTTCTTTTAATGGAAAAAAGAACTCAGGTGGATCACTTTGAGAAGATGCCAGAAATAGCAGCATTGTTGAAAGCAATTTTATGTGTAAATTTGTTTGCTTTGCTGATGATATTCATACTCTCCCCTTCTCACTCTTTTTCCCCAACATTAATTCTAGTGTAATTTTATATATATATATATATATA


Protein Sequences

MLLHPLFLLFFFFTFFSNPSLLSFSLSQEGLYLHTIKLSLDDPDSALRSWNDRDDTPCSWFGVSCDPQTNSVHSLDLSNTNIAGPFPSLLCRLQNLSFLSLYNNSINMSLPSVISNCTSLHHLDLSQNLLTGELPASISDLPNLRYLDLTGNNFSGDIPESFARFQKLEVLSLVYNLLDGPMPAFLGNITSLKMLNLSYNPFEPSRIPPEFGNLMNLEVLWLTQCNLVGEIPESLGRLKRLTDLDLALNNLDGSIPESLMELSSVVQIELYNNSLTGELPSGFSKLTSLRLFDASMNGLTGEIPDELCQLPLESLNLYENKFEGKLPESIANSPGLYELRLFGNRLTGELPSNLGKNSPMRWIDVSNNQFTGKIPGNLCEKGELEELLMINNQFSGEIPASLGSCESLTRVRLGYNQFSGEVPAGFWGLPHVYLLELVSNSFSGKISDAIATAKNLSIFIISKNNFTGMLPAEMGRLENLVKLLATDNKLNGSLPESLANLRHLSSLDLRNNKLSGELPSGIKSWKNLNELNLANNEFTGEIPEEIGNLPVLNYLDLSGNLFYGDVPLGLQNLKLNLLNLSNNHLSGELPPFLAKEIYKNSFLGNPDLCGHFESLCNSKAEAKSQGSLWLLRSIFVLAGFVFIVGVIWFYLKYRKFKMAKREIEKSKWTLMSFHKLDFSEYEILDCLDDDNIIGSGSSGKVYKVVLNNGEAVAVKKLFGGLRKEGEKGDIEKGQVQDNAFEAEIDTLGKIRHKNIVKLWCCCVTRDYKLLVYEYMPNGSLGDLLHSSKKGLLDWPTRFKIALDAAEGLSYLHHDCVPPIVHRDVKSNNILLDGDFGARLADFGVAKVIDSTGKGPKSMSVIAGSCGYIAPEYAYTLRVNEKSDIYSFGVVILELITGRLPVDPEFGEKDLVKWVCYTLDQDGIDQVIDRKLDSCYKEEICRVLNIGLLCTSPLPINRPSMRKVVKMLQEVGAENQLKSSSKDGKLTPYYYEDASDQGSVA


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox