PRGWK00000051 (MELO3C004290)

From PRG Wiki
Jump to: navigation, search


MELO3C004290
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:TN
Location scaffold00003
Location Start 5812221
Organism Species:Cucumis melo
Approved true



CDS Sequence

ATGGCTTTGCGTCAAAGAGGAATCAATGTTTTTATAGATAATAAGCTTTCAAGGGGTGAAGAAATTTCTACATCTCTTTTGAAAGCTATTGAAGAATCCAAGATCTCCATTGTTATAATCTCTGAAAATTATGCATCTTCAAGTTGGTGTTTGAATGAATTGGTGAAAATCATTACGTGTAACAAATTGAGAGGACAAGTCGTTTTACCAATTTTCTACAAAGTGGATCCATCTCAGGTAGGAAAACAAAGTGGAAGATTTGGAGAAGAATTTGGGAAACTTGAAGTTAGATTCTCGTGGGACAAGATGGAAGCATGGAGGGAGGCCATGATTTCTGTTTCTCATATATCTGGATGGACGGTTCTTCAAAAAGAAGACGAGGCGAATTTGATTCAAAAAATTGTTCAAGAAGTCTCGAAGAGATTAAATCGTGGAGCAATACAATTGCGTATAGCTAAATATCCAATTGGAATAGACAGACAAATTAATAATATACTCTTTCAAGTTACGTCTGATGAAAAAATTACTATGGTTGGATTTTATGGAATTGGAGGTATTGGGAAGACAACTTTGGCCAAAGCATTATACAATAAAATTGCTAATGACTTTGAAGGATGTTGCTTTTTGGCAAATGTTAGAGAAGCTTCAAATCAATACCGGGGTCTTGTTGAACTCCAAAAAGAGCTACTTCGTGAGATTCTAATGGATGATTTAATCAAATTTAGTAATCTTGATGTAGGAATTAGCATCATAAGAGATCGACTATGCTCAAAAAAGATTCTTTTGATTCTTGATGATGTTGATACAAGTGAACAACTAGAAGCATTAGTGGGAGAACATGATTCATTTGGACCAGGAAGTATGGTCATTGTGACAACAAGAAACAAACATGTACTTGTTATTCATGAATTTGATATATTGCAAAGTGTTCAGGGATTGAAGGATGATGAAGCCCTCAAGCTTTTTAGCTGGCATGCTTTTAAGCAGAGTTGTCCATCAAGTGATTATTTAGACCTTTCAAAACGTGCCGTACGTTATTGTGATGGTCTTCCCTTGGCTCTTGAAGTTGTAGGTTCATTCCTTCACTCCATCGAACAATCCAAATTTAAACTTATATTGGATGAATATGAAAACCAATACCTTGACAAGGGCATACAAGATCTTCTTCGAATAAGTTACGATGGACTTGAAGATGAAGTAAAAGAAATTTTTCTTTATATANNNNNNNNNNNNNNNNNNNNGATATTGAATTTACTTTTATTCTTTTCTTATTTAAACATAGAAAGAAAGAAAAAAATGTATAAGGAAAATTTCATTTTTTTTTTTTGCTACCTTTTTATTGTTATTCTTTTTAAAAAAAAAAAAAAGCATTTTAACATTTTTCTTCTCTCTGTTAAAAAGAGAGAAAAAGAAAAAAGTTATAAGCAAAAAGTCTTATATTATTATTATTTTTATATTTATTATATATATAGTTTTTTCTTTTTCTTTGCCGTCATCCCTCTGTTTTCTTTTTTTTTTTAA


Protein Sequences

MALRQRGINVFIDNKLSRGEEISTSLLKAIEESKISIVIISENYASSSWCLNELVKIITCNKLRGQVVLPIFYKVDPSQVGKQSGRFGEEFGKLEVRFSWDKMEAWREAMISVSHISGWTVLQKEDEANLIQKIVQEVSKRLNRGAIQLRIAKYPIGIDRQINNILFQVTSDEKITMVGFYGIGGIGKTTLAKALYNKIANDFEGCCFLANVREASNQYRGLVELQKELLREILMDDLIKFSNLDVGISIIRDRLCSKKILLILDDVDTSEQLEALVGEHDSFGPGSMVIVTTRNKHVLVIHEFDILQSVQGLKDDEALKLFSWHAFKQSCPSSDYLDLSKRAVRYCDGLPLALEVVGSFLHSIEQSKFKLILDEYENQYLDKGIQDLLRISYDGLEDEVKEIFLYIXXXXXXXILNLLLFFSYLNIERKKKMYKENFIFFFCYLFIVILFKKKKKHFNIFLLSVKKREKEKSYKQKVLYYYYFYIYYIYSFFFFFAVIPLFSFFF


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox