PRGWK00000380 (Solyc00g294230.1.1)

From PRG Wiki
Jump to: navigation, search


Solyc00g294230.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:TN
Location SL2.30ch00
Location Start 21157931
Location End 21158937
Organism Species:Solanum lycopersicum
Approved true



CDS Sequence

ATGTTTCATGCTTCTTCCAAAGTTTGCAAGTACGATATCTTTTTGAGTTTTAGAGGTGAGGATACGCGTAGAACCTTTGTGAGTCATCTCTATAATGCTTTGGAACAGAGAGGAATCCATGCTTTCAAAGACGATGAACGATTGGAAGCAGGACAATCACTTTCTATGCCATCAAAATTCCCCTTTCGCGGATTCATTTTTCCAACACGAGGTGCATTTGCGGAGGCAGGCAATATATCAGGCTATCATTTACTAAATTTCAAAGATGAGGCTGAGTGCGTCAAGAAACTTGTTGATGACATATTTCCTAAGTCACTTCAAATTATTTCACCTTTTCCGGAAAGCTTAGTGGGTATGAGATCTCAGGTTGAGGAAGTAATCGAATTATTAAGTATGGAATCAAATGATGCTCGCTCTATTGGTATTAGTGGTATGGGTGGCATCGGCAAATCAGAACTTGCACGTGTTCTGTATGAAAGATACCGCCATCTATTTGAAGCTGATTGTTTTCTTGGTGATGTTGGAGAACTTCATCATAAAAATGGACTAGCATGGCTGGCACAAGTCGTCATTCGCAAGCTCTTGGGTGAAAAGANNNNN


Protein Sequences

MFHASSKVCKYDIFLSFRGEDTRRTFVSHLYNALEQRGIHAFKDDERLEAGQSLSMPSKFPFRGFIFPTRGAFAEAGNISGYHLLNFKDEAECVKKLVDDIFPKSLQIISPFPESLVGMRSQVEEVIELLSMESNDARSIGISGMGGIGKSELARVLYERYRHLFEADCFLGDVGELHHKNGLAWLAQVVIRKLLGEKXX


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox