PRGWK00000414 (Solyc01g016360.1.1)

From PRG Wiki
Jump to: navigation, search


Solyc01g016360.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:RLP
Location SL2.30ch01
Location Start 19076628
Location End 19077679
Organism Species:Solanum lycopersicum
Approved true



CDS Sequence

ATGATCAGTTGGCAGGGGGTTCTCGTGGGTTACGGTTGTGGACTTGTTATTGGACTGTCCGTAATATACATAATGTGGTCAACTCAATATCCAAATGTACCAGTTGACCTGAGCATCACTGTCATATATACAACAACAAACAATGAGTTGAATGACACGTTTCCGAAATGGTTGGGAGACCTACCTCATTTGCATATCTTAAATTTGAGATCAAATAAGTTGTATGGCACTATAAGGACTAACTACTTGTTTGCTCAAATTCGAGTCATAGATCTCTCATCCAATGGATTTAGTGGAGAGTTACCAGTGAGCCTGTTTCAGATTATTTTTTATATATCGATGAAAATATCGACCTCCTTCATCCTCAAAGCACTTAACTTTAACTCTTCATTTTTGAATATTACAGGATTCAAGTCTATTGAGTTGCTGGAAATGCAGATAAAAGCCTTTTTTTTTTAG


Protein Sequences

MISWQGVLVGYGCGLVIGLSVIYIMWSTQYPNVPVDLSITVIYTTTNNELNDTFPKWLGDLPHLHILNLRSNKLYGTIRTNYLFAQIRVIDLSSNGFSGELPVSLFQIIFYISMKISTSFILKALNFNSSFLNITGFKSIELLEMQIKAFFF


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox