PRGWK00000472 (Solyc02g031800.1.1)

From PRG Wiki
Jump to: navigation, search


Solyc02g031800.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:RLP
Location SL2.30ch02
Location Start 17709415
Location End 17709693
Organism Species:Solanum lycopersicum
Approved true



CDS Sequence

ATGTACAAGCTTAAATTTCTAGATTTATCACAGAACAACTTCAGTAATTTGATTCCAAGTTGCTTCGGAAGTATGACTAATCTAATGGCGTTGGACTTAAGAAGTAATAATTTCACAGGGAGTAGTCCACCATTATGTGCGCAGAGTACTTCATTGAGAACCATTGTCCTGAATGGTAACCAATTTGAACGACCTGTGCTGATGTCGTTGATCAACTGTGATGGTCTAGAAATCCTTGATGTGGGTAACAACACTATAGATGACACATTTACAGCTTAG


Protein Sequences

MYKLKFLDLSQNNFSNLIPSCFGSMTNLMALDLRSNNFTGSSPPLCAQSTSLRTIVLNGNQFERPVLMSLINCDGLEILDVGNNTIDDTFTA


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox