PRGWK00000474 (Solyc02g032060.1.1)

From PRG Wiki
Jump to: navigation, search


Solyc02g032060.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:RLP
Location SL2.30ch02
Location Start 18143275
Location End 18144009
Organism Species:Solanum lycopersicum
Approved true



CDS Sequence

ATGCAAATCCCTTTTGGAAATATCTCAAAACCAATCCCAAATTTCATTTGTGATCTTAAAAATCTTACCTTTCTTGATTTTAACCATAATTTCATCCCTGGAAACTTCCCTCATATCTACAATTGTTCAAATCTTGAATTTTTAGACCTTTCTTATAACTACATAGATGGTAATCTCCCTGATGAGATTAACCGTTTTTCGAGTAATCTAAAGTACCTAAATATAACAGCCAACAACTTCAATGGTGATATACCTAATGGAATCGGTGGTTTGAGTCAGCTCAAAGTACTTGAGCTGATGAGCTTGAATCCTTTTGCTCCACAAGCTATACCTTCAAGATTCACAAAGTTGAAAAAATTGAAAAAATTTTGGATGACAGAAGCAAATTTGATTGGAAATATCCCTGAAAATATTGGTAATATGACAAGTCTTGAATTTTTGGATTTGTCGAAAAATGGATTGAGTGGTAGTATCCCTGATGGTTTGTTTCAGCTGAAGAATTTGAGTATTGTCTATTTGTATACTAACAAACTGTCAAGGGAAATACCGCAGTTAGTTTCATCAAGGAGTTTAAATGTTGTTGATTTGTGTAACAATAGTTTGACAGGAAGAATACCAGAAGATTTCGGAAAATTGACAAAAATGACTGGATTGTCTTTGTTTTAA


Protein Sequences

MQIPFGNISKPIPNFICDLKNLTFLDFNHNFIPGNFPHIYNCSNLEFLDLSYNYIDGNLPDEINRFSSNLKYLNITANNFNGDIPNGIGGLSQLKVLELMSLNPFAPQAIPSRFTKLKKLKKFWMTEANLIGNIPENIGNMTSLEFLDLSKNGLSGSIPDGLFQLKNLSIVYLYTNKLSREIPQLVSSRSLNVVDLCNNSLTGRIPEDFGKLTKMTGLSLF


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox