PRGWK00000497 (Solyc02g070730.1.1)

From PRG Wiki
Jump to: navigation, search


Solyc02g070730.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:N
Location SL2.30ch02
Location Start 34946608
Location End 34947832
Organism Species:Solanum lycopersicum
Approved true



CDS Sequence

ATGGCTGAAGCAGCAGTTTCCTATGTTGCAGAGCGATATATTAAGCAAGAGGAAGATGAAGCCGCAACAATCCGCTATTGGGTATCTGAAATCAGAGCAGTTGCCTACCATGCTGAGGATGTCATTGAAATATTCATCCAACAAGTTGAGTCCCAAAAACGTCAAAGTTTCTTCATCAAGTGTATCTTCTATCCTAAGAAACTATACGGTCTTTACAAAGTAGGGAAAGAGATTGAATCAATTCAGACCAGAATACTTGAAATATCCAACAGTCTTGAAAGATATGGCATCAGGCATATTCAAGGTCTCAGAGATGGGGAAGGTTCAAGCACAACACGTGAGAAGATGCGTGAACGAAGACTCTCCTCGCCCTTGATTGAGGACAAACGGCTTCGTGTTGCTTCAATTGTTGGTATGGGGGGCGTCGGCAAGACGACTCTCGCGAAGGAAGTTTATAACCAAACTCAAATCAGAGAAAAGTTTGACATTCGGGCATGGCTTTATGTATCCCAAGATTATAAGCCCATGAAGATCATCAAGGAACTCATTTTACAACTGGCAAGTCCAGAAGAAGATAAAGTGAAGATAGTCGATACGATGGACAAATTGTCACAGGCTGGTTTGGAGGAAATGCTCCAGAGGCGTTTGAAAGATACATGCTATCTCATTGTTCTTGATGACATCTGGACACAGAAGCATGGGATCTCATTGTTAGATCATTTCCTGACAACAATAAGTCAAGTAGATTGCTACTTACCAGCCGCAGTAAGGAGGTTGCCTTGCATGCAGATGCTCATACTACACTTTACGAACATAAAGTATTTGAGTAAAGAGGAGAGCTGGGAACTCTTTCTCAAGATAGAAAATGCCGAGGATAGAGAGTTTCCACATGACTTGGTGGGCGTGGGGAAAGAGATTCTGGAAAAATGTGACGGTTTGCCACTGGCAATCACTGTCATTGGAGGCCTCTTGGCTGTCAAAGTTATGGTGTATCAGCAATTTTGGCATTGA


Protein Sequences

MAEAAVSYVAERYIKQEEDEAATIRYWVSEIRAVAYHAEDVIEIFIQQVESQKRQSFFIKCIFYPKKLYGLYKVGKEIESIQTRILEISNSLERYGIRHIQGLRDGEGSSTTREKMRERRLSSPLIEDKRLRVASIVGMGGVGKTTLAKEVYNQTQIREKFDIRAWLYVSQDYKPMKIIKELILQLASPEEDKVKIVDTMDKLSQAGLEEMLQRRLKDTCYLIVLDDIWTQKHGISLLDHFLTTISQVDCYLPAAVRRLPCMQMLILHFTNIKYLSKEESWELFLKIENAEDREFPHDLVGVGKEILEKCDGLPLAITVIGGLLAVKVMVYQQFWH




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show

Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox