PRGWK00000759 (Solyc05g052590.1.1)

From PRG Wiki
Jump to: navigation, search


Solyc05g052590.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:Pto-like
Location SL2.30ch05
Location Start 61946495
Location End 61948879
Organism Species:Solanum lycopersicum
Approved true



CDS Sequence

ATGACATCATCCATCTCCGGCACCGGCGCCGGTTTATTCGCCGCCGTAATTGTACTGATAACTTCTGTTTTACTACCATTTTCTCATGCTCTCGGTAGTTCCGCCACCACTTTGGCCGTTGCATACGGCGCCAACATCACTATCTGCGGCATAGTAGCTTCTCAACCAATCCAAAGAATTCATTGCTGGTCAGAAAATCAATCAGAATCCATCCCCATATCTCCTAACGTCTCCTTTAACTCCATCGCCGGCGGAGTTAACGGCTTCACCGGCGTTGAAGCCGGTGGGTTTTCCCTTCTCTTCTGGAACTCAACTTTTCAACCCAAAAGACTTTTCTTCAGTCGCTCAACTTTGTTAACATCTGTTACAATGGGGGATACTCAAATTTGCGGCTTAACAAACGGTACCCAAAATGTTAAATGTTGGAGAGATGACTCGAATTTGGGTAAACAACCAAATGGGTCGTCACAATTCATGTCAATTTCATCTGGGTCGGGATTTTCTTGTGGAATTTTGAAAAGTTCAAATAGGGTTATATGCTGGGGAAACAATAGCGATATTGCTTCAGCTATTCAATCTGGTTTTGGTAATATTACAGTGATGAATATATTTGCAGGTGGAAAACATGCTTGTGGGATGAATTCTACAGGTTTTTTAATTTGCAAAGGAGATAATGAAAATGGTCAATTAGATATTCCATCTAATTTTGCTTATGAGTATAATGGATTAGCTTTAGGGGTAAATCATACTTGTGGGGTTCTTAGAATGAATTATACAGTTGTTTGTTGGGGTGGGAATGGTGAATTTTCGACAAATTTAACGAAAGATCTTTCATTTGAATCAATTGTTGCTGGTTTAGATTTTACTTGTGGATTAACAAGTGGGAATTTTTCTGTTATCTGTTGGGGACCTGGTTGGAGTAGTAATATGTATCCATCAGGTACTGAGCTTCCTTTACCAATGATTCTTCCAGGTCCATGTGTTGAGAATGTATGTGATTGTGGTGTATATCCTCAATCGAAAACGTTGTGTTCGGGGAATGGTAATATATGTAGGCCTTGTGATTTTTCGGTTGGAGTAGCTCCACCACCATCACCACGGGTGTTTATTATAGTGCCATCGTCGCCATCTAAGGGGTTGAGAAAGGGATTGTTAGCTTTTGTGATTGTTGGATCAGTTGGGGCTATTGCAGGGATTTGTACTGTTGTTTATTGTTTATGGACTGGTGTTTGTTTTGGGAAGAAGAAAATTCATAATTCTGTTCAACCTACTATTAGTACTAATAATGCTGCTCAACAATGTTATAGTAGTGGTCAAATTTCCAGATCGTCTACTCTTAGGCGTCAAGGGTCGAGGTTAATGAGGCGTCAAAGGAGTGGAACTTCGTCTATACATGGTGACAGAGCAGAGGAGTTTCTGTTTTCGGAGCTTGTTGCAGCTACGGACAATTTCTCTTTAAAGAAAAAGATTGGTGCTGGCAGCTTTGGGGTTGTTTACAAGGGAAAATTAGCTGATGGCCGTGAGGTTGCAATTAAGCGTGGTGAAACGAGTCCGAAGATGAAGAAATTCTTAGAGAAAGAGAGGGCTTTTGAATCAGAATTGACGTTTTTGTCCCGACTACACCATAAACACTTGGTTAGATTGGTTGGTTATTGTGAAGAAATGGATGAAAGGCTCTTGGTTTATGAGTTTATGAAGAATGGGGCGCTTTATGATCATTTACACGATAAGAACAACGTGGAGAAGAGTAGTAGTGTAGTGAATTCTTGGAAAATGAGGATCAAGATTGCATTAGATGCTGCTCGTGGCATCGAATACCTTCACAATTATGCAGTTCCCCCTATAATTCACCGGGACATCAAGTCATCCAACATCTTGATCGATGCAAATTGGATCGCGAGGGTGTCAGATTTTGGATTATCGTTAATGTGGCCGGAGACTGATACCAGTTTCAGTCAGCCAATGAGGGCAGCAGGCACAGTTGGGTATATCGATCCAGAATACTATGGACTAAATGTCTTGACAGCAAAGAGTGATGTCTATGGCCTTGGGGTTGTATTGTTAGAACTTTTGACCGGAAAAAGAGCCTTATCCAAAACTAGTGAAAACGGGGACATGCCAATGAGTGTTGTCGACTTTGCAGTACCAGCAATCATGGCTGGAGAATTGAACAAGATATTGGATCCCCGAGTTGGGCTGCCAGAGTTGACGGAAGCAGAGGGAGTCGAATTAGTGGCATACACTGCAATGCATTGTGTGCATTTGGAAGGAAAACATAGACCTACAATGACTGACATTGTTTCTAACTTAGAGAGAGCTTTGGCTGCATGTGATGATAGCCATGACAGCATCTCTAGTAGTCCAGACTCCATTAAATCAGATTGA


Protein Sequences

MTSSISGTGAGLFAAVIVLITSVLLPFSHALGSSATTLAVAYGANITICGIVASQPIQRIHCWSENQSESIPISPNVSFNSIAGGVNGFTGVEAGGFSLLFWNSTFQPKRLFFSRSTLLTSVTMGDTQICGLTNGTQNVKCWRDDSNLGKQPNGSSQFMSISSGSGFSCGILKSSNRVICWGNNSDIASAIQSGFGNITVMNIFAGGKHACGMNSTGFLICKGDNENGQLDIPSNFAYEYNGLALGVNHTCGVLRMNYTVVCWGGNGEFSTNLTKDLSFESIVAGLDFTCGLTSGNFSVICWGPGWSSNMYPSGTELPLPMILPGPCVENVCDCGVYPQSKTLCSGNGNICRPCDFSVGVAPPPSPRVFIIVPSSPSKGLRKGLLAFVIVGSVGAIAGICTVVYCLWTGVCFGKKKIHNSVQPTISTNNAAQQCYSSGQISRSSTLRRQGSRLMRRQRSGTSSIHGDRAEEFLFSELVAATDNFSLKKKIGAGSFGVVYKGKLADGREVAIKRGETSPKMKKFLEKERAFESELTFLSRLHHKHLVRLVGYCEEMDERLLVYEFMKNGALYDHLHDKNNVEKSSSVVNSWKMRIKIALDAARGIEYLHNYAVPPIIHRDIKSSNILIDANWIARVSDFGLSLMWPETDTSFSQPMRAAGTVGYIDPEYYGLNVLTAKSDVYGLGVVLLELLTGKRALSKTSENGDMPMSVVDFAVPAIMAGELNKILDPRVGLPELTEAEGVELVAYTAMHCVHLEGKHRPTMTDIVSNLERALAACDDSHDSISSSPDSIKSD




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show

Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox