PRGWK00001144 (Sotub01g005130.1.1)

From PRG Wiki
Jump to: navigation, search


Sotub01g005130.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:N
Location 1
Location Start 131914
Location End 132309
Organism Species:Solanum tuberosum
Approved true



CDS Sequence

ATGCGTTTTCTGAGCATGGAGGAAAGCTGGACTCTTTTACGCGATAAGGTTTTTGGGAATGGTGGTTACCCTCCGGAATTGGAGAAAATTGGGAGGTACATTGGCCATCAGTGTCAAGGGTTGCCACTTGCAGTTGTTGCAATTGGTGGACTACTTTCCAAGATGAGCAAGGAAACAAGTTCTTGGGAGAATGTTGCAGAAAAGGTAGGATCACTTATGACCAGCGACACTATGGATTGCTTGAACA


Protein Sequences

MRFLSMEESWTLLRDKVFGNGGYPPELEKIGRYIGHQCQGLPLAVVAIGGLLSKMSKETSSWENVAEKVGSLMTSDTMDCLNILSLSYNHLPQYLKTCFLYMGVFAETREIPVWKLIKLWIAEGFVKRVNHK


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox