PRGWK00001150 (Sotub01g005860.1.1)

From PRG Wiki
Jump to: navigation, search


Sotub01g005860.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:CNL
Location 1
Location Start 673859
Location End 677411
Organism Species:Solanum tuberosum
Approved true



CDS Sequence

ATGCAAGTCGGTGACACTGTCTCGGGACCAAGGGCAGACTTATCTTCTGCTGAAGTCAAAGAAGGTTATAAGTTTCTCCTTTCATTGGTTCCAGGGAGGTGGCCTTTACCAAATTTATGCAGCCCAGTGTTTCAGAAATTCATTGAGCACATCCTTCAGAATGTGAAGGATCTTCTCATCAACAAGAAAGATTTCGACAAGTTTGTACTTCTGAAGAAAGAGTTTCAAGTCCTTGAAGAAAGTCTA


Protein Sequences

MQVGDTVSGPRADLSSAEVKEGYKFLLSLVPGRWPLPNLCSPVFQKFIEHILQNVKDLLINKKDFDKFVLLKKEFQVLEESLKYLKTFLNFIKDASMELEKSNILFNHIEGITVNAAYICYLCYVEEMDGDSASVLTLQISHVLKYIKPIDPDVAEIYTGALRGSVKLQIQYSRDVIEFVEGFVHFIFKDLLELSDGEACSLMLPLKKDQIKSLAEASKQLYLLLSLSIAEVVSAAFSFSVDKAAE


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox