PRGWK00001395 (Sotub03g014730.1.1)

From PRG Wiki
Jump to: navigation, search


Sotub03g014730.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:RLK
Location 3
Location Start 19041890
Location End 19045708
Organism Species:Solanum tuberosum
Approved true



CDS Sequence

ATGGCTACTGGGTTTTCTTCTACTACTGCCATTGTTGTCTTTCTTCTCTGTTTCTGTGTTTCTAATGTTGTTTTACAAAGAACAGAGGAGGACCCAGAAAGACAAATCTTGTTTTCTTTCAGGAGTTCTCTTGAAAATCCTTATGTTTTGTCTACATGGACCCCCACAATTTCACATTGCAAATGGGATGGTGTTTTCTGCCAAAATGGTCAAGTTGTTTCCCTTATTCTTTCTTCTTTGTCACTC


Protein Sequences

MATGFSSTTAIVVFLLCFCVSNVVLQRTEEDPERQILFSFRSSLENPYVLSTWTPTISHCKWDGVFCQNGQVVSLILSSLSLKGPISPHIASLKSLRVLDLSNNQLSGELPIHLSELSLLETIKLGSNCFTGEISPEFGRLTEMKLLDLSGNALTGKIPAQLGQLTKLQVLALGNNLLSGSLSATLFTKLQSLTSFDVSNNTLSGIIPPEIGGLRSLTDLYIGENRFSGHLPAEIGELSRLEIFLA


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox