PRGWK00001449 (Sotub04g006480.1.1)

From PRG Wiki
Jump to: navigation, search


Sotub04g006480.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:T
Location 4
Location Start 1360811
Location End 1361293
Organism Species:Solanum tuberosum
Approved true



CDS Sequence

ATGAATCAACAAAAAAGTAGTAGTAGTACTTCTTTGCTTCCAATAACTCCCGAAATTATTCGTTGGAGTTACGATGTTTTTCTAAGTTTTAGAGGTGAAGATGTACGTAAAACTTTTGTTGATCATCTCTATGTTGCTCTTCAACAAAAAGGGATCAACACATTCAAAGATTCTGAGAAATTAGAGAAAGGTAATTCTATTTCACCAGGACTTATGAGAGCAATTGAAGAATCGCGCATATCTTTGA


Protein Sequences

MNQQKSSSSTSLLPITPEIIRWSYDVFLSFRGEDVRKTFVDHLYVALQQKGINTFKDSEKLEKGNSISPGLMRAIEESRISLIIFSKNYANSRWCLDEVAKIMECKNVKGQIVIPVFYDVDPSTVRKQKSSFEEAFNNYEDCFKVQKWRGALEEAANLSGW


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox