PRGWK00001562 (Sotub04g015530.1.1)

From PRG Wiki
Jump to: navigation, search


Sotub04g015530.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:CN
Location 4
Location Start 18001234
Location End 18002751
Organism Species:Solanum tuberosum
Approved true



CDS Sequence

ATGGCTGATGCCTTTCTATCATTTGCAGTTCAAAAATTGGGTGATTTCCTAATACAACAAATTTCCCTGCGTAAAAATCTGAGAAAGGAAATTGAGTGGCTGAGAAATGAGCTACTCTTCATACAATCATTCCTCAAAGATGCAGAACAAAAACAATATGGAGATAATAGAGTTCAACAATGGGTGTTTGAGATCAACTCTATTGCTAATGATGCTGTTGCTATACTCGAGACTTATAGCTTCGAG


Protein Sequences

MADAFLSFAVQKLGDFLIQQISLRKNLRKEIEWLRNELLFIQSFLKDAEQKQYGDNRVQQWVFEINSIANDAVAILETYSFEAGKGASRVKACACICRKEKKFYNVSKEIQSLKQQIMDISRKRETYGITNINSNAGEGPSNQSAMVRTLRRTTSYVDDQDYIFVGLQDVVQALLAQLLKAEPRRSVVSIYGMGGLGKTTLARNLYRSPNMVSSFPTRAWICVSQEYNTMDLLKTTIKSIQGRTKET


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox