PRGWK00001567 (Sotub04g018000.1.1)

From PRG Wiki
Jump to: navigation, search


Sotub04g018000.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:RLP
Location 4
Location Start 34734559
Location End 34735191
Organism Species:Solanum tuberosum
Approved true



CDS Sequence

ATGGTGAAATGTGGAAAGGGCCATGATATGTACCTGAACTCAGAGTCTTGGATCTCACCAACAATAGCCTCACGGGTATGCGGTATGATCCCTCCTTTTGTTGGAAATGCCACAAACATGATCAACTTCAGTTTGTTTGGAAATAGAGTTAGCGGCAACATTCCAAAGGAGATCAGTAATCTGAGCCAACTAGAAGACTTGTCCTTGAGTGATAATCAATTAACAAGTTCCATTCCCACGACACAGT


Protein Sequences

MVKCGKGHDMYLNSESWISPTIASRVCGMIPPFVGNATNMINFSLFGNRVSGNIPKEISNLSQLEDLSLSDNQLTSSIPTTQFNISSLLALHLLNNSLSGPLLQDEGNIVSNLEVLRISHNQISGCIPSNICRILTKLKMLSLSFNNITGEIPRNIGCLAKLEVLSIGRNAMSGTIHASLGNISTLENLGCSHSRIVGHSIHYRSSSFEP


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox