PRGWK00001628 (Sotub05g006760.1.1)

From PRG Wiki
Jump to: navigation, search


Sotub05g006760.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:RLK
Location 5
Location Start 1314260
Location End 1318381
Organism Species:Solanum tuberosum
Approved true



CDS Sequence

ATGGAAACAAGAAGTGTTTTTGGTTTTGTGGTGTTGTTGAGTTTCTTGGTTTACTCTAATGCTATGCTTACTCCTGGTGGTGTTAATTATGAAGTGCAAGCTTTAATGGAGATCAAGAACTCATTACATGATCCACTTGGTGTTTTGAATTGGGATGAAAGTTCTGTTGATCCATGTAGCTGGAATATGATCACTTGTTCAAATGATAAATTTGTCACTGGCTTGGCTTGTTCAAGCCAAAGTTTG


Protein Sequences

METRSVFGFVVLLSFLVYSNAMLTPGGVNYEVQALMEIKNSLHDPLGVLNWDESSVDPCSWNMITCSNDKFVTGLACSSQSLSGKISPYIHNLTHLDLLLLQSNNITGPIPTELGMLQKLNTIDLSDNQLTGKIPSSLAQLKSLQYLRLNNNSLSGAVPLELSNMTQLTLLDLSFNNLSGPVPRLLAKTFNLLGNPIICATGKEPECNGTTTSMPLPFTLNNSQNAQPFGRSKTHKIALAFGTSLGC


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox