PRGWK00001960 (Sotub08g020850.1.1)

From PRG Wiki
Jump to: navigation, search


Sotub08g020850.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:RLP
Location 8
Location Start 35272562
Location End 35275003
Organism Species:Solanum tuberosum
Approved true



CDS Sequence

ATGGAAAAAGAAAAGCTAATCTCTCTCTGGATGGCACTCGGTTTTCTTTTATCAAAAGGAAAGGAGTTAGAGGATGATGGTAATGAAGTATGGAACAAATTATGCTTGAGGTCTGTCTTCCAAGAGATTGAAGTTAAATCTGGTAAAACTTATTTCAAGATGCATGATCTCACCCATGATTTGGCTACATCTCTGTTTTCTGCAAGCACATCAAGCAGCAATATCCGCGAAATAAATGTAGAAAGT


Protein Sequences

MEKEKLISLWMALGFLLSKGKELEDDGNEVWNKLCLRSVFQEIEVKSGKTYFKMHDLTHDLATSLFSASTSSSNIREINVESYSHMMSIGFTELVSSYSPSLLQKFVSLRVLNLSDLGLKQLPSSIGDLVHLRYLNLSGNWNMRSLPKELCKLQNLQTLDIYNCQSLCCLPKQTSQLGSLRNLLLENCYRLTFMPPRFGSLTCLKTLDFFAVGEKEGSQLSELGNLNLYGSISIKHLERVKNDKDAN


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox