PRGWK00002004 (Sotub09g014490.1.1)

From PRG Wiki
Jump to: navigation, search


Sotub09g014490.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:RLK
Location 9
Location Start 19586401
Location End 19589472
Organism Species:Solanum tuberosum
Approved true



CDS Sequence

ATGTTGTGGCATATAATAACTGTTTTATCTTTAGCTCCATTTCTGGTACACTCTTTAGACCCAGCATTCAATGATGATGTAATGGGTTTAATTGTTTTGAAAGCTGGATTCACTGACCCTAAATCTAAACTTGCATCTTGGACAGAAGATGATCCTACTCCTTGTAATTGGGTTGGTATAAATTGTTATCCTCAATCCAATAGAGTTTCTGAGATTTTACTTGATAATTTCTCTCTTTCTGGACAT


Protein Sequences

MLWHIITVLSLAPFLVHSLDPAFNDDVMGLIVLKAGFTDPKSKLASWTEDDPTPCNWVGINCYPQSNRVSEILLDNFSLSGHIGRSLLRLQFLKVLSLSNNNFTGNINPILSQIPSLRVIDLSHNTLSGSIPDEFFQQCSSLQSVSFANNNLTGEIPQSLTSCSTLQRVNFSSNRLSGPLPSALWSLTSLQSLDVSDNLMEGEIPKAIEGLYSLRSINLHKNKFTGWLPENIGNCVQLKSIDLSDNL


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox