PRGWK00002173 (Sotub10g028030.1.1)

From PRG Wiki
Jump to: navigation, search


Sotub10g028030.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:NL
Location 10
Location Start 52548872
Location End 52550132
Organism Species:Solanum tuberosum
Approved true



CDS Sequence

ATGATAACGGGTAAAAAGAAAATCCTAAAACTTTGCTATGATTATCTACCATTTCCACATCTGAAAAAATGCTTTGCCCACTTCGCAATTTTTCCAAAAGATTTTGTGTTTGGAAAGGACCAACTAATCCAACTCTGGATGGCGGAAGGGTTTCTTCGTCCATGTCAAGAGATCCCTGTGATGGAAGACGTTGGGAACATGTATTATCAACCTCTATTGCAATATTCCTGGCTGCAAGATGTTGAGT


Protein Sequences

MITGKKKILKLCYDYLPFPHLKKCFAHFAIFPKDFVFGKDQLIQLWMAEGFLRPCQEIPVMEDVGNMYYQPLLQYSWLQDVELDEHSNIRCCKMHYLAGDILKSKLFDQKSVGGENLSQVRYFGWNSPSDQIDMINEPGHICIFWHIYGPMMNQKTEVNDEYVLDGLQPHPNLKKIVVVNYLRTRFPSWFSEELLPNLVKLKLSGCRKCKEIPSLGQLKLLRHLELIGFHELECIGPTFLWC


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox