Property:Has DNA Sequence

From PRG Wiki
Jump to: navigation, search

This is a property of type Text.

Property:Has Sequence


Pages using the property "Has DNA Sequence"

Showing 12 pages using this property.

P

PRGAV00000029 +GCAACGCAGGCATCGTTTCGCATCCTGGTGGCATATTTCGCCTCGGGTGCGAATTGTCATATTTCATGCGGTCTACTGACCGCCCGCCGCGTTTTTGAGGTCATTTACGCGTATAGGTCCTCCGCAACCGTCCATCGCTCACACTGCCGCGCTGGCGATACCGACGCACACCAGTGAGAGCAGCCCGACGCAGGTGCCGCACTTGCAGGGCAACACCCCGCCACTGCGGGAACGTGCGCGTCGCCGCGCCGTCAGCGTACCTCCGCTGGTGTCATTGAACGACAGCGCGATGACCGGCAAGCCGGCCTTGGTGGCGTTGGACAGCGAATTCTCAGAGCAGCGCCTGGCCGAAGTGCAGGCGCGGCAGATCACCGTGCAGGCACTGCAAGGCAAGCTTGCCGCGCATCTTGCGCAGGCCGGCACGGCGCTCACGCCCGACAGCATTGCCGCACGCTTCGCCGCCGGCGCACTGGAGCCGGTGTATCTGGATACGGCTGCATTCAATGCCATGTCGCGCGGGTTGCCCGCACGCGCACGTGCGGCGGCCGGTCCCGTGCTGATCGATGCGCAGCAGGGTCGCATCGTCTTCAATCTGCAGCGCGCGTTTGCGTCTGGCGACACCTTCAGCGACGCGGCGCTGACCGCGCTGGGCAAGGCGCTGGATCTACCCGGCCACGGGCTGGCGACGCCGGACTGGCCGCAGCCCGCCGCACGCACGCCGACGCGGCGCAAGTTGGAGCACGCCCCGCGCTACCACGGTCACGAGGTGCCGGCGCGCGACGGTGGCGCTGCGTTCTTCAAGGCCAACGACCATCGCCTGCTGGAAGGAAGGCAAGCGCTGTTGCGCAATCATCGAAAAGCGCTCGTGCACGACCACTACTTCGAAGCACCCAGCACGCGTGCGTTAGGAAAGGACGTGATGGTGCATCGCGGGCTGTTCGATAACCACGCCGGCATCCCGGAAAATTCGTTGTCGTCCATCGATAATGCTTACGCGAAGGGCTATCGTAATCTGGAGCTGGACGTCGAAGTCAGTGCCGATGGAGTACCGGTGTTGATGCACGATTTCAGCGTGGGCCGCATGGCAGGCGATCCGGAGAACCGCCTGGTGTCGCAGGTTCCGTTTGCGGAGTTGCGTGAAATGCCGTTGGTGATCCGCAACCCGTCTGACGGCAACTACGTCAAAACCGACCAGACCGTCTCCGGCGTGGAGCAGATGCTGGAACACGTGATCAAAAAGCCCGAGCCGATGTCGGTGGCGCTGGATTGCAAGGAGAATACCGGCGAGGCGGTGGCGATGCTGCTGATGCGCCGGCCGGACCTGCGCAATGCTGCAGCGATCAAGGTCTATGCCAAGTACTACACCGGAGGCTTTGATCAATTTCTGTCCAATTTGTACAAGCACTACCAGATCAACCCGTTGCACTCTCAGGACGCGCCACGCCGCGCCGCGCTGGATCGCTTGCTGACCAAGATCAACGTGGTGCCGGTCTTGAGCCAGGCCATGTTGAACGACGAGCACTTGCGCGGTTCCTTTCGGAGCAATGACGACGGCGCGGAGGGCCTCGCAGACACCGCAATGCAGTGGCTGGAAAGCTGGACCAGGATGCGCCCGGTGATTGTGGAGGCAGTGGCCACCGACGACAGCGATGCGGGTAAGGCCATGGCCATGGCGCGTGGGCGGATGCGCCAGCCGGACTCGGCCTACGCAAAGGCCGCCTATTCGGTGAGCTACCGGTTTGAGGACTTTTCCGTGCCGCGCGCCAATCACGACAGGGACTACTACGTTTACCGCAACTTTGGCGAGCTGCAAAAGCTCACCAACGAGGAATTCGGCGTCAAGCGCACCACGGCCGGCGCGTTCCGCGATGACGGCGAAAGCCTGCTGACCGACCAGGCCGAGGCGGAATTGCTCGCCATCCTGGAAAACCGCACGCTGGCCCGCGGCCATACCGGCAACGAACTCGACGTGCCGCCGGAAACGCCTATCGATGTCAACCGGGACGCCGAGATCGTGAAGCAACGCACCCGCGAATTCCAGGCTGGCTTCATCCCCGCCGACCCGAACCACATCGCAGCGGTTCGCGAAGGCAAACAACGCGATCACAGAGCAGACATGGTGCATGACCCTGCAGAAACGCGTGCGGTGGATAAGCGCGCTCAAGCGTCTGGTTTGTTGACCGAAAAATACCGTGGTGCTCCTGTGACGCATTATCTCAATGAGCAGGCCAACCAGACCGAGCCGGATTGA
PRGAV00000030 +GAGGGTCGGCAGGGATTGGTGTAAAAAACAGCCAAAAGTGAGCTAACTCGCTGTCAGCACAGAAATTTTTCACAACCTTCTGCCGATCCTCCATGCGGGTCCGTGATCGCCTTCATGTCTGCGCCTCACCCTGGTCGTCGAGGGTTGCCAGGATCACCCGAAGTTGTGTACTGCCATGCGGCCTCGGAAGCTATGTAGGAACCACAGACCGCTAGTCTGGAGGCGACCATGTAAAGAGGTATGCCTGATGGATCCCATTCGTTCGCGCACACCAAGTCCTGCCCGCGAGCTTCTGTCCGGACCCCAACCCGATGGGGTTCAGCCGACTGCAGATCGTGGGGTGTCTCCGCCTGCCGGCGGCCCCCTGGATGGCTTGCCCGCTCGGCGGACGATGTCCCGGACCCGGCTGCCATCTCCCCCTGCCCCCTCACCTGCGTTCTCGGCGGACAGCTTCAGTGACCTGTTACGTCAGTTCGATCCGTCACTTTTTAATACATCGCTTTTTGATTCATTGCCTCCCTTCGGCGCTCACCATACAGAGGCTGCCACAGGCGAGTGGGATGAGGTGCAATCGGGTCTGCGGGCAGCCGACGCCCCCCCACCCACCATGCGCGTGGCTGTCACTGCCGCGCGGCCGCCGCGCGCCAAGCCGGCGCCGCGACGACGTGCTGCGCAACCCTCCGACGCTTCGCCGGCCGCGCAGGTGGATCTACGCACGCTCGGCTACAGCCAGCAGCAACAGGAGAAGATCAAACCGAAGGTTCGTTCGACAGTGGCGCAGCACCACGAGGCACTGGTCGGCCATGGGTTTACACACGCGCACATCGTTGCGCTCAGCCAACACCCGGCAGCGTTAGGGACCGTCGCTGTCAAGTATCAGGACATGATCGCAGCGTTGCCAGAGGCGACACACGAAGCGATCGTTGGCGTCGGCAAACAGTGGTCCGGCGCACGCGCTCTGGAGGCCTTGCTCACGGTGGCGGGAGAGTTGAGAGGTCCACCGTTACAGTTGGACACAGGCCAACTTCTCAAGATTGCAAAACGTGGCGGCGTGACCGCAGTGGAGGCAGTGCATGCATGGCGCAATGCACTGACGGGTGCCCCCCTGAACCTGACCCCGGAGCAGGTGGTGGCCATCGCCAGCAATATTGGTGGCAAGCAGGCGCTGGAGACGGTGCAGGCGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCCACGATGGCGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGGAGCAGGTGGTGGCCATCGCCAGCCACGATGGCGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCAATGGCGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGGAGCAGGTGGTGGCCATCGCCAGCAATAGCGGTGGCAAGCAGGCGCTGGAGACGGTGCAGGCGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCAATAGCGGTGGCAAGCAGGCGCTGGAGACGGTGCAGGCGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGGAGCAGGTGGTGGCCATCGCCAGCAATATTGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCCACGATGGCGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCAATGGCGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGGAGCAGGTGGTGGCCATCGCCAGCAATATTGGTGGCAAGCAGGCGCTGGAGACGGTGCAGGCGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCAATAGCGGTGGCAAGCAGGCGCTGGAGACGGTGCAGGCGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGGAGCAGGTGGTGGCCATCGCCAGCAATATTGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGGAGCAGGTGGTGGCCATCGCCAGCAATGGCGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGGAGCAGGTGGTGGCCATCGCCAGCAATATTGGTGGCAAGCAGGCGCTGGAGACGGTGCAGGCGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGGAGCAGGTGGTGGCCATCGCCAGCAATGGCGGCGGCAGGCCGGCGCTGGAGAGCATTGTTGCCCAGTTATCTCGCCCTGATCCGGCGTTGGCCGCGTTGACCAACGACCACCTCGTCGCCTTGGCCTGCCTCGGCGGACGTCCTGCGCTGGATGCAGTGAAAAAGGGATTGCCGCACGCGCCGGCCTTGATCAAAAGAACCAATCGCCGTATTCCCGAACGCACATCCCATCGCGTTGCCGACCACGCGCAAGTGGTTCGCGTGCTGGGTTTTTTCCAGTGCCACTCCCACCCAGCGCAAGCATTTGATGACGCCATGACGCAGTTCGGGATGAGCAGGCACGGGTTGTTACAGCTCTTTCGCAGAGTGGGCGTCACCGAACTCGAAGCCCGCAGTGGAACGCTCCCCCCAGCCTCGCAGCGTTGGGACCGTATCCTCCAGGCATCAGGGATGAAAAGGGCCAAACCGTCCCCTACTTCAACTCAAACGCCGGATCAGGCGTCTTTGCATGCATTCGCCGATTCGCTGGAGCGTGACCTTGATGCGCCTAGCCCAATGCACGAGGGAGATCAGACGCGGGCAAGCAGCCGTAAACGGTCCCGATCGGATCGTGCTGTCACCGGTCCCTCCGCACAGCAATCGTTCGAGGTGCGCGTTCCCGAACAGCGCGATGCGCTGCATTTGCCCCTCAGTTGGAGGGTAAAACGCCCGCGTACCAGTATCGGGGGCGGCCTCCCGGATCCTGGTACGCCCACGGCTGCCGACCTGGCAGCGTCCAGCACCGTGATGCGGGAACAAGATGAGGACCCCTTCGCAGGGGCAGCGGATGATTTCCCGGCATTCAACGAAGAGGAGCTCGCATGGTTGATGGAGCTATTGCCTCAGTGAGGCTCAGTCGGTGACTACCTGAGCGTCTGCAGGGATTGGTGTAAGTAACCTTTACTGACAGCGAGTTAGCC
PRGAV00000031 +ATGCGGTTTTGCGCCGCCACCAGCACGGCGTTGCAGGCAACCAGCGTGTCATCACGCACATAGTTCTGATCGAGGGTCGGCAGGGATTGGTGTAAAAAACAGCCAAAAGTGAGCTAACTCGCTGTCAGCACAGAAATTTTTCACAACCTTCTGCCGATCCTCCATGCGGGTCCGTGATCGCCTTCATGTCTGCGCCTCACCCTGGTCGTCGAGGGTTGCCAGGATCACCCGAAGTTGTGTACTGCCATGCGGCCTCGGAAGCTATGTAGGAACCACAGACCGCTAGTCTGGAGGCGACCATGTAAAGAGGTATGCCTGATGGATCCCATTCGTTCGCGCACACCAAGTCCTGCCCGCGAGCTTCTGCCCGGACCCCAACCCGATGGGGTTCAGCCGACTGCAGATCGTGGGGTGTCTCCGCCTGCCGGCGGCCCCCTGGATGGCTTGCCCGCTCGGCGGACGATGTCCCGGACCCGGCTGCCATCTCCCCCTGCCCCCTCACCTGCGTTCTCGGCGGGCAGCTTCAGTGACCTGTTACGTCAGTTCGATCCGTCACTTTTTAATACATCGCTTTTTGATTCATTGCCTCCCTTCGGCGCTCACCATACAGAGGCTGCCACAGGCGAGTGGGATGAGGTGCAATCGGGTCTGCGGGCAGCCGACGCCCCCCCACCCACCATGCGCGTGGCTGTCACTGCCGCGCGGCCGCCGCGCGCCAAGCCGGCGCCGCGACGACGTGCTGCGCAACCCTCCGACGCTTCGCCGGCCGCGCAGGTGGATCTACGCACGCTCGGCTACAGCCAGCAGCAACAGGAGAAGATCAAACCGAAGGTTCGTTCGACAGTGGCGCAGCACCACGAGGCACTGGTCGGCCATGGGTTTACACACGCGCACATCGTTGCGCTCAGCCAACACCCGGCAGCGTTAGGGACCGTCGCTGTCAAGTATCAGGACATGATCGCAGCGTTGCCAGAGGCGACACACGAAGCGATCGTTGGCGTCGGCAAACAGTGGTCCGGCGCACGCGCCCTGGAGGCCTTGCTCACGGTGGCGGGAGAGTTGAGAGGTCCACCGTTACAGTTGGACACAGGCCAACTTCTCAAGATTGCAAAACGTGGCGGCGTGACCGCAGTGGAGGCAGTGCATGCATGGCGCAATGCACTGACGGGTGCCCCCCTGAACCTGACCCCGGAGCAGGTGGTGGCCATCGCCAGCAATATTGGTGGCAAGCAGGCGCTGGAGACGGTGCAGGCGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGGACCAGGTGGTGGCCATCGCCAGCAATGGCGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGGAGCAGGTGGTGGCCATCGCCAGCAATATTGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGGAGCAGGTGGTGGCCATCGCCAGCAATATTGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGGAGCAGGTGGTGGCCATCGCCAGCAATGGCGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGGAGCAGGTGGTGGCCATCGCCAGCAATGGCGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGATCCCGCAGCAGGTGGTGGCCATCGCCAGCAATATTGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGACCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCAATAGCGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGGAGCAGGTGGTGGCCATCGCCAGCAATGGCGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCAATATTGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGACCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCAATAGCGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCAATGGCGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCCACGATGGCGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCCACGATGGCGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCAATAGCGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCCACGATGGCGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCAATGGCGGTGGCAAGCAGGCGCTGGAGACGGTGCAGCGGCTGTTGCCGGTGCTGTGCCAGGCCCATGGCCTGACCCCGCAGCAGGTGGTGGCCATCGCCAGCAATGGCGGCGGCAGGCCGGCGCTGGAGAGCATTGTTGCCCAGTTATCTCGCCCTGATCCGGCGTTGGCCGCGTTGACCAACGACCACCTCGTCGCCTTGGCCTGCCTCGGCGGACGTCCTGCGCTGGATGCAGTGAAAAAGGGATTGCCGCACGCGCCGGCCTTGATCAAAAGAACCAATCGCCGTATTCCCGAACGCACATCCCATCGCGTTGCCGACCACGCGCAAGTGGTTCGCGTGCTGGGTTTTTTCCAGTGCCACTCCCACCCAGCGCAAGCATTTGATGACGCCATGACGCAGTTCGGGATGAGCAGGCACGGGTTGTTACAGCTCTTTCGCAGAGTGGGCGTCACCGAACTCGAAGCCCGCAGTGGAACGCTCCCCCCAGCCTCGCAGCGTTGGGACCGTATCCTCCAGGCATCAGGGATGAAAAGGGCCAAACCGTCCCCTACTTCAACTCAAACGCCGGATCAGGCGTCTTTGCATGCATTCGCCGATTCGCTGGAGCGTGACCTTGATGCGCCTAGCCCAATGCACGAGGGAGATCAGACGCGGGCAAGCAGCCGTAAACGGTCCCGATCGGATCGTGCTGTCACCGGTCCCTCCGCACAGCAATCGTTCGAGGTGCGCGTTCCCGAACAGCGCGATGCGCTGCATTTGCCCCTCAGTTGGAGGGTAAAACGCCCGCGTACCAGTATCGGGGGCGGCGGTACGCCCACGGCTGCCGACCTGGCAGCGTCCAGCACCGTGATGCGGGAACAAGATGAGGACCCCTTCGCAGGGGCAGCGGATGATTTCCCGGCATTCAACGAAGAGGAGCTCGCATGGTTGATGGAGCTATTGCCTCAGTGAGGCTCAGTCGGTGACTACCTGAGCGTCGGCAGGGATTGGTGTAAGTAACCTTTACTGACAGCGAGTTAGCCCACTTTTGGCTGTTTTTTACACAAATCCCTGCCTCCCCTCTAGTTGCGCAAGATGCCCGCGCTTGGTACCAGAGGCATCGTAGGCCGTGAGCTTGTTCAGTGGCGGCAACCGCTTGAAGCCTGCTGCC
PRGAV00000032 +CTCCGCCCAACATTCGACAATTCTCAACATGAAGCTCTTCATACTGACCTTCATTTGGCTACTTACCGCATCCGAAGTAATAGCAGCAGCCAAAAAACTACCTGGCTGCGACAAAGATCCTTGCAAAGTGAAGGAGAAGTCTGGAAAGTATAAATTGAAGATTGGTGCTAAATGCTCGGCGACATGTGACGGGAAGTTGACGAGGGGAGGAACGTGTGAGAATGTGCAGGGTAATCACCTTTGCTGTTTTGGTCTTTGCGGTTGATGAATGTCAGCTGTGGCATCAGAACGGGGATTGCGCGAACGATTTTGGATGGAGACAGTGTGAGAAGAGTATGCTAAGCGATGGGATCAATAGGTACTTCGCTTGTACCCAGATCTGCCTCAATTTTTTTATGTCCCAAAAAAAAAAAAA
PRGAV00000033 +TGCAGGCATGCTTACCTGTACCACTAAGCCAAGCGGGCGATACTGCAACGCAGATGAGTCAGCAAGGCGTAGATACAATATGTAGCTACGCAAAAGCGGTGAGAAAAGAGGCCACAAAAATGGACTGATGTGGCGAGCTGGACTTGGGCCGGCAATACAGAACTTCTGCTCCGTAACATGCTTACACCATTGCAAGTTTGCGACTACAGGATTACATTCTGCTCTGTATGCCAAGTGCTGTAGCATGTTCTACGCATTTGGGTTCTATCGTTGTCGTTACCAACGATTGGGCTCTACAAAATCTCGACTATGGACCAAGTCTTGGCATTTCACGAGAGCTTGGTACATGCGGAGAAAAAGACCCACGTGCCACCTAACCGACTTCACAGCTCACAACTTACACTGCATTGCAACAACATCTTGCCATCATACTTGATCTTTGCTATCTACGGAACCTACCACTTCCCCGAACCCTCGCTAGCCGACCGAGCCCTATTATCTGCCGCCTATTTGAACGAACTTTAATATACATTGCGCCTCGAAAGCCTCTAGCATCTATCTTTTTCGCGTACTCGAGCCGGCAACGAGTAGGAGAGGGGCCCTTACGAGGCAGGGGTATGCTCCCCGCCGATATGCCCTCCCCGAGGCTCAACGGCAACGTGCAGGATAGTCGACATTTAATGCACTTTAATTAGGATTTAACAAGGCAACTAGGGACCGGTCGGCTAGCTAGGGATCGGGGAAGTGTCGAGGTTCTACGGAATGGCACAGCTTCAATGCGTAGTGGCCAATTCCAATTTCTATGACCTAGACCAACAGCAGTACTATGACCATGAACCCGGCACGGCGACCACGGTAGGTCTGTACACGAGCCACAATAAGGCATGCTTTTTACAGGTTGCAAGGGAAAACGAAATTGGACATACGCAGGTCCAAAATAGCTCAGGAAGAGATTCAGGACATAATTTAAGCAGATCGCGACCTTCGACACGATCCCAAATCGCACTACTCAACGATCACACGACCTAGCGACTACAAGCACTCAAGGCATCCACAGCGATGCACTACACAACCCTCCTCCTAAGCACTCTCCTAGTCGGCACAGCCCTCGCCCAACCCACAAATCCTCCTGCGAAGACTCCCAAGAAGGCCCCCAAAACTCAACCATACAACCCATGCAAGCCCCAAGAAGTCATCGACACCAAGTGTATGGGTCCCAAGGATTGTCTCTACCCGAACCCCGACAGTTGTACAACCTACATACAGTGTGTACCGCTCGACGAAGTTGGCAATGCGAAGCCTGTGGTTAAGCCATGTCCAAAAGGACTGCAGTGGAACGATAACGTTGGCAAGAAGTGGTGCGACTATCCAAACCTGAGTACGTGTCCGGTAAAGACGCCGCAACCGAAGCCGAAGAAGGGAGGTGTCGGAGGGAAGAAGGCGTCGGTTGGACATCCTGGCTATTGAGTCGGACAAGAAAGGGGATAACGCAGTGTAAGGGACGTGGATAGATGGACGATGGGGCTGCTCTGACATCTATGTCTATTGTTTATACAACACATGAATTATGTACAATTAGTAAGGACCAGCAAGGTGAAATAACTGCGAACAAGATAGCGCTCAGCCGATATGCGGTACATTCCATGACCCAGTTCGTTGCGAGATGCTCCTGGCTGCATATACAACAGACGTCGAACCATTTCCGCTGTCAGCGCGAACCTAGCCAAGAAATACAGCATCGCTGTACACCAGAAGCACGAAGTCGACAAACTATGACCTCCAGATCGACGCAGGGTAAGGTAAAACGGCAGGAGGATTGGTCCGGCGACTGTCCTGTGATGCTCGCTATACGCCAGACCCAGAGATCGATAGTCGTTGGAAAGTACCAGTCCCAAGCCAGCAGATGCATGACTCCGATAGGACACTGGCCAAGATGAATAGGACGAGCCCACAGCGTCTTCTCTTCCTCAGTTCCGGACTTCCAGAAGTTTCCTGGC
PRGAV00000034 +AGGGTTCGAGTGGCCCGGTATATCGCTGTGCGACCTGCACAGGCAGTTTCACGAAGGCGAACCCGATCAAAGGCCTGCAAACCGCGGTCCGCAGCGAAAGCCTGACCTACATTCCACAACCTCACCCCACTATACCGAGGACGATCCAGCATGCAGTTTCCAACCCCTCACCTCCTGCTCACCACCCTCCTCGCTACTATCACAACCGCCGATTTCTCGCGCGATTGCCCGCCAGGCAGCGGCGTTGGCAATCAAGCCGAATGGAGCGCACGCGGCGTAGATGGCACTGCGATCCCTAGAGAACTTGACGCTCACAGCCTCTGTGACTGCTTCAAGCCGTTCTTGAACGTGCTGGGATGTTCGGTCACATCGGTTGTGACGGAGAGAGCTGTTTTTGTGAAGGGACATCTCAACTATTGTGCGCGGATGTCGGAGTCGGTGGCAGGGATCTCGCCGTGTAAGGAGTGGGAGATTGAGGTTGGGGGAGCGCATCCTGAGAGGATGGCAAACAGATAGATCAGCGGTAGACACCTAAATTCCATAGTCGACTGTTTGCCTCGCGAAAGAAAAAAAAAAAAAAAAAAAA
PRGAV00000035 +AACACTACGAATTTCGAAAAATCCTCAAGCCTACTAAGGTCTTTGTAGCCATAGTCATTTTAATAAGTCTATCGACTTACGTATCTATCATGAAGCTTTCCCTCCTTAGCGTAGAGCTTGCTCTCCTAATTGCTACTACTCTCCCACTTTGCTGGGCAGCTGCCCTCCCTGTAGGATTGGGAGTCGGGCTAGACTACTGTAACTCAAGTTGTACTAGGGCCTTCGACTGTTTGGGTCAATGTGGCAGATGCGACTTTCATAAGCTACAATGTGTCCACTAGAGGACTAGAGAGGAAGTGGAGAGAAGAGGAGGGGAGAGGTACGATAACTAGCGAGTAAATCGTACAGGTAGAAAGGGATAGTAAGCAGGCAGATAGACGGACGACGTTGCGACCTTATCCAACATAAGTCCTAGTCGTAACATTCGTTCATATTGAAGGCTTTTCCTCAATAGTTTCTCAAATGTGCTGCGAGGCGCAGAGCCAAG
PRGAV00000036 +GTCGACGGATCTGAACCTGGTGGTCGGCCAGAAGCACAATGCCACGGTGGGTGGCGACATGGTGGAGAGGATTCAGGGGCTGCGTGAGAGCATCACCAGTAAAAGCCAGCGTTTTCAGGCTCCTAAAAACTGGGTTGGGTCCAGCACTGTGAACATCTTTCAGGTGGTGTGCGACTTGCTGGATCTGGTCCAGGAAATGAATACCCAGCTTGCCGCGCACCAGCATGGGCCATCCCCGATACCGAGTAACGCAGCTGCGTTTACGGCGGACGCAGCCAAGGCAGCGTTACTGTGCGCCAAACTCAAGTCAGTGACGCTTTGATGTCTAAACCCGGCGCCAGCAAAATTTTGGGGAATTATCTTATAAGCTTGGAACCGATCCGCTCCCTATGACCACTCAAGTGGCGTCATAAATGCTGTACTAAAGAGGGTATACGAATGGGAAATATATGTGTCGGCGGATCCAGGATGGCCCATCAGGTGAACTCCCCAGACCGAGTTAGTAACAACTCGGGTGACGAAGATAACGTAACGTCCAGTCAACTGCTGAGCGTCAGACATCAACTTGCGGAGTCTGCTGGTCTACCAAGAGATCAGCATGAATTTGTTAGTAGCCAAGCACCTCAAAGCCTGAGAAATCGCTACAACAATCTTTACTCACATACGCAAAGAACACTGGATATGGCGGACATGCAGCATAGGTACATGACGGGAGCGTCAGGAATCAATCCGGGAATGCTGCCACATGAGAATGTGGACGATATGCGTAGCGCTATAACTGATTGGAGTGACATGCGCGAAGCTCTGCAGCACGCAATGGGTATCCATGCCGACATCCCACCGTCTCCAGAGCGATTTGTTGCGACTATGAACCCGAGCGGATCAATTCGAATGTCAACACTTTCTCCTAGCCCGTACCGTAACTGGCAATGATGTCAAGCCGTGTGTGGCGTCATAATGTCGACGCACACGGCCTGCATCTGTGATGCAATCCGTTGTGATCGCCTGATCTAAAATTCTACGTATTTACAGGTGAGTGCAGAGGTTCTTCAGTGCGTCACAACGGTCGATAGACAAAACTAAAGAGCAGTTAATTATAAGATGTGTCTCTAGA
PRGAV00000037 +AAAGGTGTGATGGAACTCTTTCCTGCTCTTTTTCCACACAGAGCTGATCTTGCGTGTGATTCGGTCCGCAGGCAGAAGATCGGAGAGGATCAGCATATGGCGGGTATCAATGGAGCGGGACCATCGGGCGCTTATTTTGTTGGCCACACAGACCCCGAGCCAGCATCGGGGGGCGCACACGGATCCAGCAGTGGCGCGAGATCCTCGAACAGTCCGCGCTTGCCGGCGCCTCCGGATGCACCCGCGTCGCAGGCGCGAGATCGACGCGAAATGCTTTTGCGAGCCAGGCCGCTGTCGCGCCAAACCAGGGAGTGGGTGGCGCAGGGTATGCCGCCAACGGCGGAGGCTGGAGTGCCCATCAGGCCGCAGGAGTCTGCCGAGGCTGCAGCGCCGCAGGCACGTGCAGAGGAAAGACACACGCCGGAGGCTGATGCAGCAGCGTCGCATGTACGCACAGAGGGAGGACGCACACCGCAGGCGCTTGCCGGTACCTCCCCACGCCACACAGGTGCGGTGCCACACGCCAATAGAATTGTTCAACAATTGGTTGACGCGGGCGCTGATCTTGCCGGTATTAACACCATGATTGACAATGCCATGCGTCGCCACGCGATAGCTCTTCCTTCTCGAACAGTACAGAGTATTTTGATCGAGCATTTCCCTCACCTGCTAGCGGGTGAACTCATTAGTGGCTCAGAGCTCGCTACCGCGTTCCGTGCGGCTCTCCGTCGGGAGGTTCGCCAACAGGAGGCGTCAGCCCCCCCAAGAACAGCAGCGCGGTCCTCCGTAAGGACGCCGGAGCGGTCGACGGTGCCGCCCACTTCTACGGAATCATCATCGGGCAGCAACCAGCGTACGTTATTAGGGCGGTTCGCCGGGTTGATGACGCCTAATCAGAGACGTCCGTCGAGCGCTTCGAACGCGTCTGCCTCTCAAAGGCCTGTAGACAGAAGCCCGCCACGCGTAAACCAGGTACCCACAGGCGCTAACAGGGTTGTGATGCGTAATCATGGTAATAACGAGGCCGACGCCGCGCTGCAAGGATTGGCTCAGCAGGGGGTTGATATGGAGGACCTGCGCGCCGCGCTTGAAAGACATATATTGCATCGCCGCCCGATCCCCATGGATATAGCGTACGCCTTGCAGGGTGTGGGCATTGCGCCAAGTATCGATACGGGAGAGAGCCTTATGGAAAACCCGCTGATGAATTTGAGTGTTGCGCTGCACCGCGCACTAGGGCCTCGTCCCGCTCGTGCTCAAGCGCCTCGTCCAGCCGTTCCGGTGGCTCCCGCGACCGTCTCCAGGCGACCAGATAGCGCGCGTGCCACAAGATTGCAGGTAATACCGGCGCGGGAGGATTACGAAAATAATGTGGCCTACGGAGTGCGCTTGCTGAGCCTGAATCCGGGCGCGGGGGTCAGGGAGACTGTTGCGGCCTTTGTAAACAACCGTTACGAGCGGCAGGCGGTTGTTGCCGACATACGCGCAGCCCTAAATTTATCTAAACAATTCAATAAGTTGCGTACGGTCTCTAAGGCCGATGCTGCCTCCAATAAACCGGGCTTCAAGGATGCGGCGGACCACCCAGACGACGCGACGCAATGCCTTTTTGGTGAAGAATTGTCGCTGACCAGTTCGGATCAGCAGGTGATCGGCCTGGCAGGTAAGGCAACGGACATGTCGGAGTCTTACAGCCGAGAGGCAAATAAGGACCTGGTGTTCATGGATATGAAAAAACTTGCCCAATTCCTCGCAGGCAAGCCTGAGCATCCGATGACCAGAGAAACGCTTAACGCCGAAAATATCGCCAAGTATGCTTTTAGAATAGTCCCCTGACCGCGCTGACAGCTAAAAGCC
PRGAV00000038 +ATGCGTCTGGCAATTATGCTGTCTGCTACGGCTGTCGCCATAAACTTTGCAACCAGCAGTGCAATCGACCAAACCAAGGTCCTGGTGTATGGGACGCCAGCTCACTACATACACGATTCAGCCGGCAGAAGACTTCTTCGCAAGAACGAAGAGAATGAAGAAACGTCTGAGGAGCGAGCCCCAAATTTCAATTTGGCGAATCTAAATGAGGAGATGTTTAATGTGGCTGCGTTGACGGAGAGAGCAGATGCCAAAAAGCTAGCGAAACAGCTTATGGGTAATGATAAGCTGGCGGATGCTGCATACATGTGGTGGCAGCACAACAGGGTTACGCTAGACCAGATTGACACGTTCCTGAAGCTTGCAAGCCGCAAGACGCAAGGCGCAAAGTACAATCAGATCTACAATAGCTACATGATGCACCTGGGGCTCACTGGATATTAG
PRGAV00000039 +ATGGAAGCAAATACATATCTCAACGCAATCATACTTGTGCTTGTGGTAACAATCATAGCAGTCATTAGTACTTCCTTAGTGAGGACTGAACCTTGTGTCATCAAGATTACTGGAGAATCAATCACAGTGTTGGCTTGCAAATTAGATGCAGAAACCATCAGAGCCATCGCCGATCTCAAGCCACTCTCCGTTGAACGGTTAAGTTTCCATTGATACTCGAAAGATGTCAGCACCAGCTAGCACAACACAGGCCACAGGGTCAACTACCTCAACTACCGCAAAAACTGCAGGCGCAACTCCTGCCACAGCTTCAGGACTGTTCACCATCCCGGATGGGGATTTCTTTAGTACAGCCCGCGCTATAGTAGCCAGCAATGCCGTTGCAACAAATGAGGACCTCAGCAAGATTGAGGCTATCTGGAAGGACATGAAGGTGCCCACAGACACTATGGCACAGGCTGCCTGGGACTTAGTCAGACACTGCGCTGACGTGGGCTCATCTGCTCAAACAGAAATGATAGATACAGGTCCCTATTCCAACGGCATCAGCAGAGCCAGACTGGCAGCAGCAATTAAAGAGGTGTGCATACTTAGGCAATTTTGCATGAAGTATGCCCCAGTGGTATGGAACTGGATGCTGACTAACAACAGTCCACCTGCTAACTGGCAAGCACAAGGCTTCAAGCCTGAGCACAAATTCGCTGCATTCGACTTCTTCAATGGAGTCACCAACCCAGCTGCCATCATGCCCAAAGAGGGGCTCATCCGGCCACCGTCTGAAGCTGAAATGAATGCTGCCCAAACTGCTGCCTTTGTGAAGATTACGAAGGCCAGGGCACAATCCAACGACTTTGCCAGCCTAGATGCAGCTGTCACTCGAGGTCGTATCACTGGAACAACAACCGCTGAGGCTGTTGTCACTCTCCCACCACCATAA
PRGAV00000040 +MALVVKGKVNINEFIDLSKSEKLLPSMFTPVKSVMVSKVDKIMVHKNESLSEVNLLKGVKLIEGGYVWLVGLVVSGEWNLPDNCRGGVSVCMVDKRMERADEATLGSYYTAAAKKRFQFKVVPNYGITTKDAKKNIWQVLVNIKNVKMSAGYCPLSLEFVSVCIVYKNNIKLGLREKVTSVKDGGPMELSEEVVDEFMENVPMSVRLAKFRTKPSKRGPKNNNNLGKGRSGGRPKPKSFDEVEKEFDNLIEDEAETSVADSDSY
Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox