Browse wiki

Jump to: navigation, search
Gene:PRGAV00000040
Has DNA Sequence MALVVKGKVNINEFIDLSKSEKLLPSMFTPVKSVMVSKVDKI MALVVKGKVNINEFIDLSKSEKLLPSMFTPVKSVMVSKVDKIMVHKNESLSEVNLLKGVKLIEGGYVWLVGLVVSGEWNLPDNCRGGVSVCMVDKRMERADEATLGSYYTAAAKKRFQFKVVPNYGITTKDAKKNIWQVLVNIKNVKMSAGYCPLSLEFVSVCIVYKNNIKLGLREKVTSVKDGGPMELSEEVVDEFMENVPMSVRLAKFRTKPSKRGPKNNNNLGKGRSGGRPKPKSFDEVEKEFDNLIEDEAETSVADSDSY NNLGKGRSGGRPKPKSFDEVEKEFDNLIEDEAETSVADSDSY
Has Description Movement protein (Cell-to-cell transport protein) (30 kDa protein)
Has GenBank ID 266548  +
Has GenBank Locus P29800  +
Has Name MP  +
Is Gene Type Avirulence Genes +
Is from DB true  +
Is in Species Species:Tomato mosaic virus +
SameAs http://bio2rdf.org/page/geneid:266548  +
Creation dateThis property is a special property in this wiki. 7 August 2012 14:10:08  +
Categories Avirulence Genes, manually curated  +
Last editor isThis property is a special property in this wiki. User:Cepabot +
Modification dateThis property is a special property in this wiki. 7 August 2012 14:10:08  +
hide properties that link here 
Gene:PRGDB00000054#15 + , Gene:PRGDB00000057#15 + Has AVR Gene
 

 

Enter the name of the page to start browsing from.
Personal tools
Namespaces

Variants
Views
Actions
PRGDB
META-SPECIES
Wiki
Toolbox